SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018379 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018379
Domain Number 1 Region: 50-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.08e-17
Family LIM domain 0.00092
Further Details:      
 
Domain Number 2 Region: 179-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.25e-17
Family LIM domain 0.0028
Further Details:      
 
Domain Number 3 Region: 107-144
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.16e-17
Family LIM domain 0.00047
Further Details:      
 
Domain Number 4 Region: 237-272
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000185
Family LIM domain 0.00092
Further Details:      
 
Domain Number 5 Region: 147-178
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000443
Family LIM domain 0.011
Further Details:      
 
Domain Number 6 Region: 20-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000769
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018379   Gene: ENSMMUG00000013984   Transcript: ENSMMUT00000019628
Sequence length 470
Comment pep:known chromosome:MMUL_1:5:615610:769634:1 gene:ENSMMUG00000013984 transcript:ENSMMUT00000019628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAVSQPQAAPSPLEKSPSTAILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEG
GFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGD
RVTFNGKECMCQKCSLPVSVGSSAHLPQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKC
KSCGKLLNAEYISKDGLPYCEADYHAKFGIRCDRCEKYITGRVLEAGEKHYHPSCALCVR
CGQMFAEGEEMYLQGSSIWHPACRQAARTEDRNKETRTSSESIISVPASSTSGSPSRVIY
AKLGGEILDYRDLAALPKNKAIYDIDRPDMISYSPYISHSAGDRQSYGESPQLLSPTPTE
GDQDDRSYKQCRTSSPSSTGSVSLGRYTPTSRSPQHYSRPAARRSDGEDGSFDQDNRKQK
SSWLMLKGDADTRTNSPDLDTQSLSHSSGTDRDLLQRMPGDSFHSREWFF
Download sequence
Identical sequences I0FVQ0
ENSMMUP00000018379 XP_014993470.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]