SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018431 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018431
Domain Number 1 Region: 148-268
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-33
Family Cadherin 0.00096
Further Details:      
 
Domain Number 2 Region: 577-687
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 353-462
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-27
Family Cadherin 0.0044
Further Details:      
 
Domain Number 4 Region: 681-787
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 461-575
Classification Level Classification E-value
Superfamily Cadherin-like 9.85e-21
Family Cadherin 0.0025
Further Details:      
 
Domain Number 6 Region: 259-365
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-19
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 786-906
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0035
Further Details:      
 
Domain Number 8 Region: 57-152
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000114
Family Cadherin 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018431
Domain Number - Region: 1-50
Classification Level Classification E-value
Superfamily Cadherin-like 0.000871
Family Cadherin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018431   Gene: ENSMMUG00000014024   Transcript: ENSMMUT00000019684
Sequence length 1289
Comment pep:known chromosome:MMUL_1:5:146425385:146491792:-1 gene:ENSMMUG00000014024 transcript:ENSMMUT00000019684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSIDKHTGEIQFQQNPSSEYFPIWLQLKVTDQGVPARTTTGLLVIHMEGEDVKISFSHH
LYKGLVTENCEAGTSIVTVKAFAPDSVQDSLKYSIFSGNEDGVLSLCSKSGQLTVKEPKF
LDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPRFEQSVYQASVSEGEFYNAHVI
QVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYEHTSSYSLIVQATDK
GMPRLSNTTIIKVQVTDINDNAPAFLPSEAVEIAEDSLPGVIVTHVSVHDVDLNSAFIFS
FAKESNPGTKFAIDQNTGVVVLVKTLDFEEVTEYKLLIQISDSVHRTEGALVVRVLDVND
NPPVFSRDFYQVTVPESTPVGYSVLTVSATDLESNENISYRIISSSKEFSIDPKNGTIFT
ISPILLLDKISTTQFLVEASDGGNPDLRSLTLVEIGIQDMNNYAPEFTVKSYNLSLSEDA
LIGSTLVTFSNIDHDWTHENTYVEYSIISGNLQNNFHVETNFIHSEYPYKQVGYLVLLHS
LDRETSANHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYHTHVKEGTPLGS
HITVVSANDRDTGSHAEIIYHIISGNEKGNFYLEENTGVLYLVKPLDYEEMAKFTLTVQA
SDAEKKHFSFAVVFVNVLDDNDHAPQFMFSSFNCIVPENLPVSSTICSISALDFDAGPYG
ELTYSIISSCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLTVQAKDKGDATA
SLVVWVDIEGVDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGIDGVILYSLGTS
SPFFSVNKTNGNIYLIRALPLIKSQLNKEDTMEMKIIAHSPKPDSRFASCTVFVNVSFSS
EGTPLAVFASSFSISLVVSFLVFLILICILLVLILRHKQKDTINNYEEKKTSSLDMNLRM
TQDASVLKAFQKTDDCSNEVVPVDATPEWLSLISIIEKDIVNQYRHSNSSGHCSVEGETA
EDKEIQRINEHPYRKGSDSALSDRESRVPDSGIPRDSDQLSCLSGETEVMVTAETAEASQ
TFGEGDQGEGCSTTCAQNNVLPQTVQKREAKESILADVRKESVFISGDQEVRCAALSTQT
TSDHDGRGNYHWNYLLSWEPKFQPLASVFNDIAKLKDEYLHIPGIPKEKKYFVFPPPLIT
AVAQPGIKAVPPRMPAVTLGQVPPKHPRSPIPYHLGSLPEAMTPSFSPSLSLLTMQPPAL
SPLLSEGELLGTHVSGTWHELKAEDEVQI
Download sequence
Identical sequences 9544.ENSMMUP00000018431 ENSMMUP00000018431 ENSMMUP00000018431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]