SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018432 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018432
Domain Number 1 Region: 101-221
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-33
Family Cadherin 0.00096
Further Details:      
 
Domain Number 2 Region: 528-638
Classification Level Classification E-value
Superfamily Cadherin-like 5e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 306-431
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-27
Family Cadherin 0.0039
Further Details:      
 
Domain Number 4 Region: 632-738
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-22
Family Cadherin 0.0023
Further Details:      
 
Domain Number 5 Region: 418-526
Classification Level Classification E-value
Superfamily Cadherin-like 7e-22
Family Cadherin 0.0022
Further Details:      
 
Domain Number 6 Region: 212-318
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-19
Family Cadherin 0.0024
Further Details:      
 
Domain Number 7 Region: 737-811
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000414
Family Cadherin 0.0035
Further Details:      
 
Domain Number 8 Region: 10-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000614
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018432   Gene: ENSMMUG00000014024   Transcript: ENSMMUT00000019685
Sequence length 813
Comment pep:known chromosome:MMUL_1:5:146426831:146491792:-1 gene:ENSMMUG00000014024 transcript:ENSMMUT00000019685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGEDVKISFSHHLYKGLVTENCEAGTSIVTVKAFAPDSVQDSLKYSIFSGNEDGVLSLC
SKSGQLTVKEPKFLDFEVRNEVQLIVLAESSGHRAYCKVAVLIQDENDNSPRFEQSVYQA
SVSEGEFYNAHVIQVFATDLDSGLNGLIEYSILSGNQEEAFQIDALSGVITTKAILDYEH
TSSYSLIVQATDKGMPRLSNTTIIKVQVTDINDNAPAFLPSEAVEIAEDSLPGVIVTHVS
VHDVDLNSAFIFSFAKESNPGTKFAIDQNTGVVVLVKTLDFEEVTEYKLLIQISDSVHRT
EGALVVRVLDVNDNPPVFSRDFYQVTVPESTPVGYSVLTVSATDLESNENISYRIISSSK
EFSIDPKNGELFIVAFMLICLGFKDKISTTQFLVEASDGGNPDLRSLTLVEIGIQDMNNY
APEFTVKSYNLSLSEDALIGSTLVTFSNIDHDWTHENTYVEYSIISGNLQNNFHVEKYPY
KQVGYLVLLHSLDRETSANHELVILASDSGCPPLSSTAVISIQVLDVNDNPPNFSSLSYH
THVKEGTPLGSHITVVSANDRDTGSHAEIIYHIISGNEKGNFYLEENTGVLYLVKPLDYE
EMAKFTLTVQASDAEKKHFSFAVVFVNVLDDNDHAPQFMFSSFNCIVPENLPVSSTICSI
SALDFDAGPYGELTYSIISSCFLTHGMSYDHDLFLIDPLTGDIHAKQILDYENGNKYCLT
VQAKDKGDATASLVVWVDIEGVDEFEPIFTQDQYFFTLPEKNKDRQLIGRVEASDADAGI
DGVILYSLGTSSPFFSVNKTNGNIYLIRALPLI
Download sequence
Identical sequences ENSMMUP00000018432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]