SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018469 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018469
Domain Number 1 Region: 157-351
Classification Level Classification E-value
Superfamily E set domains 7.46e-60
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000286
Further Details:      
 
Domain Number 2 Region: 55-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-21
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018469   Gene: ENSMMUG00000014053   Transcript: ENSMMUT00000019727
Sequence length 418
Comment pep:novel chromosome:MMUL_1:16:65302898:65361502:1 gene:ENSMMUG00000014053 transcript:ENSMMUT00000019727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYYGSSYHIVNVDAKYPGYPPEHIIAEKRRARRRLLHKDGSCNVYFKHIFGEWGSYVVD
IFTTLVDTKWRHMFVIFSLSYILSWLIFGSVFWLIALHHGDLLNDPDITPCVDNVHSFTG
AFLFSLETQTTIGYGYRCVTEECSVAVLMVILQSILSCIINTFIIGAALAKMATARKRAQ
TIRFSYFALIGMRDGKLCLMWRIGDFRPNHVVEGTVRAQLLRYTEDSEGRMTMAFKDLKL
VNDQIILVTPVTIVHEIDHESPLYALDRKAVAKDNFEILVTFIYTGDSTGTSHQSRSSYV
PREILWGHRFNDVLEVKRKYYKVNCLQFEGSVEVYAPFCSAKQLDWKDQQLHIEKAPPVR
GSCTSDTKARRRSFSAVAIVSSCENPEETTTSAAHEYRETPYQKALLTLNRISVESQM
Download sequence
Identical sequences A0A1D5RBD6 G7PV99
XP_001083706.1.72884 XP_005584863.1.63531 XP_005584864.1.63531 XP_005584865.1.63531 XP_011717952.1.29376 XP_011717953.1.29376 XP_011717954.1.29376 XP_011717955.1.29376 XP_011717956.1.29376 XP_011845819.1.47321 XP_014975705.1.72884 XP_014975706.1.72884 XP_014975707.1.72884 XP_014975708.1.72884 XP_015294261.1.63531 XP_015294262.1.63531 9544.ENSMMUP00000034136 ENSMMUP00000018469 ENSMMUP00000018469 ENSMMUP00000034136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]