SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018478 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018478
Domain Number 1 Region: 419-611
Classification Level Classification E-value
Superfamily vWA-like 1.53e-51
Family Integrin A (or I) domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1199-1405
Classification Level Classification E-value
Superfamily vWA-like 3.2e-46
Family Integrin A (or I) domain 0.00064
Further Details:      
 
Domain Number 3 Region: 820-1000
Classification Level Classification E-value
Superfamily vWA-like 1.1e-44
Family Integrin A (or I) domain 0.00098
Further Details:      
 
Domain Number 4 Region: 1026-1200
Classification Level Classification E-value
Superfamily vWA-like 9.32e-44
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 5 Region: 238-402
Classification Level Classification E-value
Superfamily vWA-like 3.77e-43
Family Integrin A (or I) domain 0.00051
Further Details:      
 
Domain Number 6 Region: 12-214
Classification Level Classification E-value
Superfamily vWA-like 9.49e-43
Family Integrin A (or I) domain 0.00068
Further Details:      
 
Domain Number 7 Region: 1422-1612
Classification Level Classification E-value
Superfamily vWA-like 3.26e-40
Family Integrin A (or I) domain 0.00079
Further Details:      
 
Domain Number 8 Region: 630-806
Classification Level Classification E-value
Superfamily vWA-like 8.76e-39
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 9 Region: 2190-2381
Classification Level Classification E-value
Superfamily vWA-like 5.15e-28
Family Integrin A (or I) domain 0.015
Further Details:      
 
Domain Number 10 Region: 2409-2599
Classification Level Classification E-value
Superfamily vWA-like 1.71e-27
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 11 Region: 2898-2957
Classification Level Classification E-value
Superfamily BPTI-like 4.82e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0000948
Further Details:      
 
Domain Number 12 Region: 1629-1824
Classification Level Classification E-value
Superfamily vWA-like 1.52e-17
Family Integrin A (or I) domain 0.02
Further Details:      
 
Domain Number 13 Region: 2786-2877
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000531
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018478   Gene: ENSMMUG00000014049   Transcript: ENSMMUT00000019737
Sequence length 2969
Comment pep:known_by_projection chromosome:MMUL_1:12:101179836:101252721:-1 gene:ENSMMUG00000014049 transcript:ENSMMUT00000019737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKHRHLPLVAVFCLFLSGFPTTHAQQQQAAQDSADIIFLIDGSNNTGSVNFAVILDFLV
NLLEKLPIGTQQIRVGVVQFSDEPRTMFSLDTYSTKAQVLGAVKALGFAGGELANIGLAL
DFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSDEIRYGVVALKQASVFSFGLGAQAASR
AELQHIATDDNLVFTVPEFHSFGDLQEKLLPYIVGVAQRHIVLKPPTIVTQVIEVNKRDI
VFLVDGTSALGLANFNAIRDFLAKVIQRLEIGQDLIQVAVAQYADTVRPEFYFNTHPTKR
EVITAVRKMKPLDGSALYTGSALDFVRNNLFTSSAGYRAAEGIPKLLVLITGGKSLDEIS
QPAQELKRSSIMAFAIGNKGADQAELEEIAFDSSLVFIPAEFRAAPLQGMLPGLLAPLRT
LTGTPEVHANKRDIIFLLDGSANVGKTNFPYVRDFVMNLVNSLDVGNDNIRVGLVQFSDT
PVTEFSLNTYQTKSDILGHLRQLQLQGGSGLNTGSALSYVHANHFTEAGGSRIREHVPQL
LLLLTAGQSEDSYLQAANALTRAGILTFCVGASQANKAELEQIAFNPSLVYLMDDFSSLP
ALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILFLFDGSANLVGQFPVVRDFLYKIIDEL
DVKPEGTRIAVAQYSDDVKVESRFDEHQSKPEILNLVKRMKIKTGKALNLGYALDYAQRY
IFVKSAGSRIEDGVLQFLVLLVAGRSSDRVDGPASNLKQSGVVPFIFQAKNADPAELEQI
VLSPAFILAAESLPKIGDLQPQIVNLLKSVHNGAPAPVSGEKDVVFLLDGSEGVRSGFPL
LKEFVQRVVESLDVGQDRVRVAVVQYSDRTRPEFYLNSYMNQQDVVNAVRQLTLLGGPIP
NTGAALEFVLRNILVSSAGSRITEGVPQLLIVLTAERSGDDVRNPSVVLKRGGAVPIGIG
IGNADITEMQTISFIPDFAVAIPTFRQLGTVQQVISDRVTQLTREELSRLQPVLQPLPRP
GVGGKRDVVFLIDGSQSAGPEFQHIRTLIERLVDYLDVGFDTTRVAVIQFSDDPKVEFLL
NAHSSKDEVQNAVQRLRPKGGRQINVGSALEYVSRNIFKRPLGSRIEEGVPQFLVLISSG
KSDDEVDDPAVELKQFGVAPLTIARNADQEELVKISLSPEYVFSVNTFRELPSLEQKLLT
PITTLTSEQIQQLLASTRYPPPAVESDAADIVFLIDSSEGVRPDGFAHIRDFVSRIVRRL
NIGPSKVRVGVVQFSNDVFPEFYLKTYRSQAPVLDAIRRLRLRGGSPLNTGRALEFVARN
LFVKSAGSRIEDGVPQHLVLVLGGKSQDDVSRFAQVIRSSGIVSLGVGDRNIDRAELQTI
TNDPRLVFTVREFRELPNIEERIMTSFGTSAATPAPPGVATPSPSRPEKKKADIVFLLDG
SINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGLVQYNSDPTDEFFLKDFSTKRQIIDAI
NKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQDVSLAL
TQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCP
GVTDVAKACNLDVILGFDGSRDQNVFVAQKGLESKVDAILNRISQMHRVSCSGGRSPTVR
VSVVANTPSGPVEAFDFDEYQPEMLEKFRNMRSQHPYVLTADTLKVYQNKFRQSSPDSVK
VVIHFTDGADGDLADLHRASEDLRQEGVHALILVGLERVANLERLMHLEFGRGFMYDRPL
RLNLLDLDYELAEQLDNIAEKACCGVPCKCSGQRGDRGPIGSIGPKGIPGEDGYRGYPGD
EGGPGERGPPGVNGTQGFQGCPGQRGIKGSRGFPGEKGEIGEIGLDGLDGEDGDKGLPGS
SGEKGNPGRRGDKGPRGEKGERGDVGIRGDPGNPGQDSQQRGPKGETGDLGPMGVPGRDG
VPGGPGETGKNGGFGRRGPPGAKGNKGGPGQPGFQGEQGTRGAQGPAGPAGPPGLIGEQG
ISGPRGSGGAAGAPGERGRTGPLGRKGEPGEPGPKGGIGNRGPRGETGDDGRDGVGSEGR
RGKKGERGFPGYPGPKGNPGEPGLNGTPGPKGIRGRRGNSGPPGIVGQKGDPGYPGPAGP
KGNRGDSIDQCALIQSIKDKCPCCYGPLECPVFPTELAFALDTSEGVNQDTFSRMRDVVL
SIVNDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKRKSVLLDKIKNLQVALTSKQQS
LETAMSFVARNTFKRVRNGFLMRKVAVFFSNRPTTASPQLREAVLKLSDAGITPLFLTSQ
EDRQLVNALQINNTAVGHALVLPAARDLTDFLENVRSCHVCLDICNIDPSCGFGSWRPSF
RDRRAAGSDVDIDMAFILDSAETTTLFQFNEMKKYIAYLVRQLDMSPDPKASQHFARVAV
VQHAPYESMGNASVSPVKVEFSLTDYGSKEKLVDFLSRGMTQLQGTRALGSAIEYTIENV
FESAPNPRDLKIVVLMLTGEVQEEQLEEAQRVILQAKCKGYFFVVLGIGRKVNIKEVYTF
ASEPNDVFFKLVDKSTELNEEPLMRFGRLLPSFVSSENAFYLSPDIRKQCDWFQGDQPTK
NLVKFGHKQINVPNNVTSSPTSNPVTTTKPVTTTKPVSTTTKPVTIVNQPSVKPAAAKPA
PEKPAPAKPVAAKPVATKTATVRPPVAVKPATAAKPVAAKPAAVRPPAAAAAKQVAAKPE
APRPQAAKPAATKPATTKPVVKVSREVQVSEITENSARLHWERPEPPSPYFYDLTITSAR
DQSLVLKQNLTVTDRVVGGLLAGQMYHVAVVCYLRSQVRATYHGSFSTKKSQPPPPQPAR
SASSSTINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGN
ENKFGSQTECEKVCAPVLAKPGVINVMGT
Download sequence
Identical sequences ENSMMUP00000018476 ENSMMUP00000018478 9544.ENSMMUP00000018478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]