SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018557 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018557
Domain Number 1 Region: 97-242
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.14e-32
Family AlaX-like 0.028
Further Details:      
 
Domain Number 2 Region: 3-94
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000777
Family AlaX-M N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018557   Gene: ENSMMUG00000014123   Transcript: ENSMMUT00000019823
Sequence length 411
Comment pep:novel chromosome:MMUL_1:16:53078148:53092430:-1 gene:ENSMMUG00000014123 transcript:ENSMMUT00000019823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRCQRDSYAREFTTTVVSCRPAELQTEGSNGKKVLSGFHVVLEDTLLFPEGGGQPDDH
GTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVDWERRFDHMQQHSGQHLITAVADH
LFKLKTTSWELGRFRSAIELDTPSMTTEQVAAIEQSVNEKIRDRLPVNVRELSLDDPEVE
QVRGRGLPDDHAGPVRVVSIKGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLIFL
AGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKLQNSTKILQKNNLNLLRDLAVHIA
HSLRNSPDWGGVVVLHRKEGDSEFMNIIANEIGSEETLLFLTVGDEKGAGLFLLAGPPAS
VETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRTEVQALLQDYITTQSTKE
Download sequence
Identical sequences A0A2K5WG23 F7C1U6
ENSMMUP00000018557 XP_005584373.1.63531 XP_014975293.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]