SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018596 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018596
Domain Number 1 Region: 70-251
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.86e-64
Family Rel/Dorsal transcription factors, DNA-binding domain 0.00000334
Further Details:      
 
Domain Number 2 Region: 246-379
Classification Level Classification E-value
Superfamily E set domains 1.14e-47
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018596   Gene: ENSMMUG00000014153   Transcript: ENSMMUT00000019866
Sequence length 523
Comment pep:known chromosome:MMUL_1:19:51432347:51463835:1 gene:ENSMMUG00000014153 transcript:ENSMMUT00000019866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIIDEYIKENGFGLDGGQPGPGEGLPRLVSRGAASLSTVTLGPVAPPATPPPWGCPLGRL
VPPAQGPGPQPHLVITEQPKQRGMRFRYECEGRSAGSILGESSTEASKTLPAIELRDCGG
LREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKE
IEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYD
KKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVVFSRASWEGRADFSQADVH
RQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRG
MPDVLGELNSSDPHGIESKRRKKKPAILDHFLPSHSSGPFLPPSALLPDPDFFSGTVSLP
GLEPPGGPDLLDDGFAYDPTAPTLFTMLDLLPPAPPHASAVVCSAGAVVGEPPGPEPLTL
DSYQAPGPGDGGTASLVGSNMFPNQYREAAFGGGLLSPGPEAT
Download sequence
Identical sequences ENSMMUP00000018596 9544.ENSMMUP00000018596 ENSMMUP00000018596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]