SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018598 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018598
Domain Number 1 Region: 232-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000224
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 2 Region: 388-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000553
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000018598
Domain Number - Region: 425-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0193
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 155-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0228
Family Classic zinc finger, C2H2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018598   Gene: ENSMMUG00000014156   Transcript: ENSMMUT00000019868
Sequence length 475
Comment pep:known chromosome:MMUL_1:19:51497871:51503125:-1 gene:ENSMMUG00000014156 transcript:ENSMMUT00000019868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELKPEPDARSQQAPRLGSFSPKEVSSEG
RFGGEPHHSSGPMPAGAALLALGARNPWTLWTQLTPNLPDRQPWTDKHPDLLTCGRCLQT
FPLEAITAFMDHKKLGCQLFRGPSRGQGSEREELKALSCLRCGKQFTVAWKLLRHAQWDH
GLSIYQTESEAPEAPLLGLAEVAAAVSAVVGPAAEAKSPRASGSGLTRRSPTCPVCKKTL
SSFSNLKVHMRSHTGERPYACDQCPYACAQSSKLNRHKKTHRQVPPQSPIMADTSQEQAS
AAPPEPAAHAAAPASTLPCSGGEGAGAAATAGVQEPGAPGSGAQAGPGGDTWGAITAEQR
TDPANSQKASPKKMPKSGGKSRGPGGSCEFCGKHFTNSSNLTVHRRSHTGERPYTCELCN
YACAQSSKLNRHRRMHGMTPGSTRFECPHCHVPFGLRATLDKHLRQKHPEAAGEA
Download sequence
Identical sequences XP_001110175.1.72884 9544.ENSMMUP00000018598 ENSMMUP00000018598 ENSMMUP00000018598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]