SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018638 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018638
Domain Number 1 Region: 95-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018638   Gene: ENSMMUG00000018057   Transcript: ENSMMUT00000019912
Sequence length 173
Comment pep:known_by_projection chromosome:MMUL_1:3:4560058:4579160:-1 gene:ENSMMUG00000018057 transcript:ENSMMUT00000019912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVGSWYNVTILVKMDFKELQQVDPRLLNHMRLLHSLVTSALQPMVSTIHHLHSAPGDAST
MVSWLLLGLLQPLPVADVSALLGDIAKRVYEVISVQVQDVNECFYEELNACSGRELCANL
EGSYQCVCHQEAPATSPRKLNLEWEARGLEIHLELRTPCTPHGTPLSSAENRL
Download sequence
Identical sequences ENSMMUP00000018638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]