SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018652 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018652
Domain Number 1 Region: 142-236
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.88e-24
Family SWIB/MDM2 domain 0.028
Further Details:      
 
Domain Number 2 Region: 243-287
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 8.24e-20
Family Ran binding protein zinc finger-like 0.0000507
Further Details:      
 
Domain Number 3 Region: 18-73
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 0.0000000000000589
Family SWIB/MDM2 domain 0.00062
Further Details:      
 
Domain Number 4 Region: 390-438
Classification Level Classification E-value
Superfamily RING/U-box 0.000000648
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018652   Gene: ENSMMUG00000014193   Transcript: ENSMMUT00000019926
Sequence length 444
Comment pep:known chromosome:MMUL_1:11:65798355:65828515:1 gene:ENSMMUG00000014193 transcript:ENSMMUT00000019926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKIYTMIYRNL
VVVNQQESSDSGTSVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISE
TEENSDELSGERQRKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAG
VSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEAQELSDEDDEVYRVTVYQAGESD
TDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKL
ENSTQAEEGFDVPDCKKTIVNDSKESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSS
QEDVKEFEREETQDKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKK
LKKRNKPCPVCRQPIQMIVLTYFP
Download sequence
Identical sequences ENSMMUP00000018652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]