SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018713 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018713
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.6e-17
Family PDZ domain 0.00076
Further Details:      
 
Domain Number 2 Region: 274-301
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000139
Family LIM domain 0.0014
Further Details:      
 
Domain Number 3 Region: 242-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000542
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018713   Gene: ENSMMUG00000014249   Transcript: ENSMMUT00000019993
Sequence length 316
Comment pep:novel chromosome:MMUL_1:7:113116659:113119767:1 gene:ENSMMUG00000014249 transcript:ENSMMUT00000019993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFTIVLKGPRPRGFCFVGDKDFEQPLAISRVTPRSKVALANLCIRDTITTIDGENSRNM
THLEAQNRIKGCTDNMTFTVARSKHKVWSPLVTEEGKCHPYKMNLASEPREVLHIGSAHN
RSSMPFTTSPACSTAARVITNQYSNPAKYLQLQQRPGVKDGCQRGGGERQTLRPCSASKQ
PCVIDTESEVYKMHQEKQELNEPPKQSMFFPVLQEILESEEKPSGFGSVEAPVTKVAALI
GNAQKLPMCDKCGPGIVGVKLRDHHRHPECYVGTDCGTSLKQKGHFFVEDQIHCEKHAWE
RVTPPEGYEVVTLFPK
Download sequence
Identical sequences ENSMMUP00000018713 9544.ENSMMUP00000018713 ENSMMUP00000018713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]