SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018794 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018794
Domain Number 1 Region: 307-356,395-622
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.39e-27
Family N-type ATP pyrophosphatases 0.017
Further Details:      
 
Domain Number 2 Region: 1-185
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.00000000000000177
Family Class II glutamine amidotransferases 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018794   Gene: ENSMMUG00000014310   Transcript: ENSMMUT00000020080
Sequence length 643
Comment pep:known_by_projection chromosome:MMUL_1:12:53337875:53347594:1 gene:ENSMMUG00000014310 transcript:ENSMMUT00000020080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGICCSVNFSAEHFSQDLKEDLLYNLKQRGPNSSKQLFKSDVNYQCLFSGHVLHLRGVL
TTQPVEDERGNVFLWNGEIFSGIKVEAEENDTQILFNYLSSCKNESEILSLFSEVQGPWS
FIYYQASSHYLWFGRDFFGRRSLLWHFSNLGKSFCLSSVGTQTSGLANQWQEVPASGLFR
IDLKSTAISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKP
VVPLNMMLPQAALETHCSNISNVPPTRETLQVFLTDVHIKEVIQQFIDVLSVAVKKRVLC
LPRGENLTANEVSKMCDRKANVAILFSGGIDSMVIATLADRHIPLDEPIDLLNVAFIAEE
KTMPTSFNKERNKQKNKCEISSEEFSKDDAAADDDSPDKHVSVPDRITGRAGLKELKAVS
PSRIWNFVEINVSMEELQKLRRTRICHLIQPLDTVLDDSIGCAVWFASRGIGWLVAQDGV
KSYQSSAKVVLTGIGADEQLAGYSRHRVRFQSHGLEGLNKEIMMELGRISSRNLGRDDRV
IGDHGKEARFPFLDENVVSFLNSLPIWEKANLTLPRGIGEKLLLRLAAVELGLTASALLP
KRAMQFGSRIAKMEKNNEKASDKCGRLQIISLENLSIEKETKL
Download sequence
Identical sequences A0A2K5X2F1 A0A2K6DRK2 F7BSF0
ENSMMUP00000018794 9544.ENSMMUP00000018794 ENSMMUP00000018794 NP_001181699.1.72884 XP_001106875.1.72884 XP_001106941.1.72884 XP_005573760.1.63531 XP_005573761.1.63531 XP_005573762.1.63531 XP_011716630.1.29376 XP_011716631.1.29376 XP_011716632.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]