SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018855 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018855
Domain Number 1 Region: 135-201
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018855   Gene: ENSMMUG00000014350   Transcript: ENSMMUT00000020144
Sequence length 226
Comment pep:known chromosome:MMUL_1:9:109897923:109977921:1 gene:ENSMMUG00000014350 transcript:ENSMMUT00000020144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGAGLAPSAPPVVPPAAAAPQPPALPEEPAGAKPRCPFSDIFNTSEN
SMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRLSR
AQKHSSGSSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAE
RKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDR
Download sequence
Identical sequences ENSMMUP00000018855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]