SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018898 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018898
Domain Number 1 Region: 39-284
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.65e-88
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000392
Further Details:      
 
Domain Number 2 Region: 285-487
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.75e-44
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00016
Further Details:      
 
Domain Number 3 Region: 620-796
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-33
Family AlaX-like 0.043
Further Details:      
 
Domain Number 4 Region: 545-620
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000459
Family AlaX-M N-terminal domain-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018898   Gene: ENSMMUG00000014387   Transcript: ENSMMUT00000020189
Sequence length 985
Comment pep:known_by_projection chromosome:MMUL_1:4:44219588:44232849:-1 gene:ENSMMUG00000014387 transcript:ENSMMUT00000020189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALVAAAARRLRRAIRRSLAWRGPSHRLLSSEPPAAKASAVRAAFLNFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLED
VGRDLSHHTFFEMLGNWAFGGEYFKEEACSMAWELLTQVYGIPTERLWVSYFDGDPKAGL
EPDLETRDIWLSLGVPATRVLSFGPQENFWEMGNTGPCGPCTEIHYDLAGGVGAPQLVEL
WNLVFMQHNREADGSLQPLPQWHVDTGMGLERLVAVLQGKHSTYDTDLFSPLLHAIQQGC
RAPPYLGRVGVADEGRTDTAYRVVADHIRTLSVCISDGVFPGMSGPPLVLRRILRRAVRF
SMEILKAPPGFLGSLVPVVVETLGDAYPELQRNSAQISNLVLEDEAAFLASLERGRRIID
RTLRTLGPSDMFPAEVAWSLSLSGDLGLPLDMVELMLEEKGVQLDSTGLERLAQEAAQHQ
ARQAEPVQKQGLWLDVHALGELQHQGVPPTDSSPKYNYSLRPNGSYEFGTCEAQVLQLYT
EDGTAVASVGKGQRCGLLLDRTNFYAEQGGQASDRGYLVRVGQEDVLFPVARAQVCGGFI
LHEAVAPECLQIGDQVQLHVDKAWRLACMAKHTATHLLNWALRQTLGPGTEQQGSHLNPE
QLRLDVTTQTALTPERLRAVENTVQEAVQQDKPVYMEEVPLALTAQVPGLRCLDEVYPDP
VRVVSVGVPVAHALDPASQAALQTSVELCCGTHLLRTGAVGDLVIIGDRQLSKGTTRLLA
ITGEQAQQARELGQNLAQEVKAATERLSQGSRDVAEALRLSKDIGRLIEAVETSVMPQWQ
RRELLATLKMLQRRANTAIRKLQMGQAAKKTQELLERHSKGPLIVDTVSAESLSVLVKVV
RQLCEQAPSTSVLLLSPQSMGKVLCACQVAQGAMPTFTAEAWALAVCSHMGGKAWGSRVV
AQGTGSTTDLEAALSTARAYALSQL
Download sequence
Identical sequences A0A1D5R8S5
ENSMMUP00000018898 ENSMMUP00000018898 9544.ENSMMUP00000018898 XP_001099647.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]