SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018903 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018903
Domain Number 1 Region: 180-325
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.58e-32
Family AlaX-like 0.028
Further Details:      
 
Domain Number 2 Region: 2-87
Classification Level Classification E-value
Superfamily HSP20-like chaperones 8.9e-16
Family Co-chaperone p23-like 0.00087
Further Details:      
 
Domain Number 3 Region: 121-177
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000293
Family AlaX-M N-terminal domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018903   Gene: ENSMMUG00000014123   Transcript: ENSMMUT00000020194
Sequence length 494
Comment pep:novel chromosome:MMUL_1:16:53078148:53106233:-1 gene:ENSMMUG00000014123 transcript:ENSMMUT00000020194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVHVLIEDHRIVFSCKNDDGVELYNEIEFYAKVNSKDSQDKRSSRSITCFV
RKWKEKVAWPRLTKEDIKLLQKVSTKRPPPAMDDLDFTTTVVSCRPAELQTEGSNGKKVL
SGFHVVLEDTLLFPEGGGQPDDHGTINDISVLRVTRRGEQADHFTQTPLDPGSQVLVRVD
WERRFDHMQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTTEQVAAIEQSV
NEKIRDRLPVNVRELSLDDPEVEQVRGRGLPDDHAGPVRVVSIKGVDSNMCCGTHVSNLS
DLQVIKILGTEKGKKNKTNLIFLAGNRVLKWMERSHGTEKALTALLKCGAEDHVEAVKKL
QNSTKILQKNNLNLLRDLAVHIAHSLRNSPDWGGVVVLHRKEGDSEFMNIIANEIGSEET
LLFLTVGDEKGAGLFLLAGPPASVETLGPRVAEVLEGKGAGKKGRFQGKATKMSRRTEVQ
ALLQDYITTQSTKE
Download sequence
Identical sequences A0A2K5WG57 F7BX64
ENSMMUP00000018903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]