SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018919 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018919
Domain Number 1 Region: 113-325
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.93e-88
Family Fibrinogen C-terminal domain-like 0.00000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018919   Gene: ENSMMUG00000014402   Transcript: ENSMMUT00000020210
Sequence length 326
Comment pep:known_by_projection chromosome:MMUL_1:15:3378218:3386527:1 gene:ENSMMUG00000014402 transcript:ENSMMUT00000020210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSGATMARGLAVLLVLFLHIKDLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAP
GPKGEAGINGKTGERGIPGAPGKVGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRTCKD
LLDRGHFLSGWYTIYLTNCRLLAVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFG
SRLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNRQFAKYRSFKVAGEAEKYKLVLGAFV
EGSAGNSLGAHNNHFFSTKDQDNDVSSSNCAVKFQGAWWYSDCHASNLNGLYLRGPHESY
ANGINWSAAKGYNYSYKVSEMKMRPA
Download sequence
Identical sequences A0A1D5Q9W9
9544.ENSMMUP00000018919 ENSMMUP00000018919 XP_014971885.1.72884 ENSMMUP00000018919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]