SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018921 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018921
Domain Number 1 Region: 99-312
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.09e-88
Family Fibrinogen C-terminal domain-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018921   Gene: ENSMMUG00000014403   Transcript: ENSMMUT00000020212
Sequence length 313
Comment pep:known_by_projection chromosome:MMUL_1:15:3408930:3415856:-1 gene:ENSMMUG00000014403 transcript:ENSMMUT00000020212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDRAVRVLGPATLLLTFLGLAWAVQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPG
PKGEAGTNGNRGERGPPGPPGKAGPPGSKGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHT
IYLPDCRPLTVLCDMDTDGGGWTIFQRRVDGSVDFYRDWAAYKQGFGSRLGEFWLGNDNI
HALTAQGTSELRVDLVDFEDNHQFAKYRSFKVADEKEKYNLVLGAFVEGSAGDSLTSHNN
HSFSTKDQDNDLSTGNCAVMYQGAWWYRTCHVSNLNGRYLRGAHDSFANGINWKSGKGYN
YSYKVSEMKVRPA
Download sequence
Identical sequences F7BQZ1
9544.ENSMMUP00000018921 ENSMMUP00000018921 ENSMMUP00000018921 NP_001181028.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]