SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018922 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018922
Domain Number 1 Region: 61-274
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.31e-88
Family Fibrinogen C-terminal domain-like 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018922   Gene: ENSMMUG00000014403   Transcript: ENSMMUT00000020213
Sequence length 275
Comment pep:known_by_projection chromosome:MMUL_1:15:3409034:3415846:-1 gene:ENSMMUG00000014403 transcript:ENSMMUT00000020213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELDRAVRVLGPATLLLTFLGLAWAVQAADTCPGERGPPGPPGKAGPPGSKGAPGEPQPC
LTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTIFQRRVDGSVDFYRD
WAAYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNHQFAKYRSFKVADEKEK
YNLVLGAFVEGSAGDSLTSHNNHSFSTKDQDNDLSTGNCAVMYQGAWWYRTCHVSNLNGR
YLRGAHDSFANGINWKSGKGYNYSYKVSEMKVRPA
Download sequence
Identical sequences F7BQY4
ENSMMUP00000018922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]