SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019038 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000019038
Domain Number - Region: 17-86
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0421
Family FAD/NAD-linked reductases, N-terminal and central domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019038   Gene: ENSMMUG00000014501   Transcript: ENSMMUT00000020340
Sequence length 193
Comment pep:known chromosome:MMUL_1:5:50660754:50712289:1 gene:ENSMMUG00000014501 transcript:ENSMMUT00000020340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCSVGYHLFSCHRSEKTCRRWMALDYAGISIGILGCYVSGVFYAFYCNNYWRQVYLITV
LAMILAVFFAQIHPNYLTQQWQRLRSIIFCSVSGYGVIPTLHWVWLNGGIGAPIVQDFAP
RVIVMYMIALLAFLFYISKVPERYFPGQLNYLGSSHQIWHILAVVMLYWWHQSTVYVMQY
RHSKPCPDYVSHL
Download sequence
Identical sequences ENSMMUP00000019038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]