SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019122 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019122
Domain Number 1 Region: 230-355
Classification Level Classification E-value
Superfamily Cadherin-like 7e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 443-569
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 4 Region: 126-234
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-20
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 559-670
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-17
Family Cadherin 0.0028
Further Details:      
 
Domain Number 6 Region: 30-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000116
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019122   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000020429
Sequence length 901
Comment pep:known chromosome:MMUL_1:6:137211725:137409920:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000020429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFSWGSGQESRRLLLLLLLLATWEAGNGQLHYSVSEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKSRGDLLEVNLQNGILFVNSRIDREELCGWNSECSIHLEVIVDGPLQVFHVD
VEVRDINDNPPVFPATQKNLSIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFSL
EKPSDDELVKGLGLILWKSLDREEAPEIFLVLTATDGGKPELTGTIQLLITVLDANDNAP
AFDRTLYKVRLPENVPNGTLVIKLNASDLDEGLNGDIVYSFSNDVSPNVKSKFHIDPITG
QIIVKGYIDFEESKSYEIIVEGIDMGQLPLSGHCRVIVEVEDNNDHVPDLEFKSLSLPIR
EDAPLGTVIALISVSDKDMGVNGLVTCSLTSHVPFKLVSTFKNYYSLVLDSALDRESVSA
YELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQPEYTVFVKENNPPGCHIFTVSAR
DADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDA
GVPSLGSNVTLQVFVLDENDNAPALLAPRAGGIGGSVNELVPWSVGAGHVVAKVRAVDAD
SGYNAWLSYELQPGTGGMRIPFRVGLYTGEISTTRVLDEADAPRHRLLVLVKDHGKPALT
ATATVLVSLVESGQEPKASSRALSGAVGPEVALVDVNVYLIIAICAVSSLLVLTLLLYTA
LRCSAPPTEGACAPGKPTLVCSSAVGSWSYSQQRRPRVCSGEGPPKTDLMAFSPSLPDSR
DREDQLQTTEESFAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVS
SATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPEPKKQTQVSFLLRRKGEASQPR
Q
Download sequence
Identical sequences F7GT11
XP_014996294.1.72884 ENSMMUP00000019122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]