SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019124 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019124
Domain Number 1 Region: 230-351
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-30
Family Cadherin 0.00078
Further Details:      
 
Domain Number 2 Region: 443-569
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-29
Family Cadherin 0.0013
Further Details:      
 
Domain Number 3 Region: 344-447
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-24
Family Cadherin 0.0023
Further Details:      
 
Domain Number 4 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-20
Family Cadherin 0.0043
Further Details:      
 
Domain Number 5 Region: 559-670
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 29-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019124   Gene: ENSMMUG00000014562   Transcript: ENSMMUT00000020431
Sequence length 808
Comment pep:known_by_projection chromosome:MMUL_1:6:137199501:137210275:1 gene:ENSMMUG00000014562 transcript:ENSMMUT00000020431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSIRRGREAWTWLLSLLLLAAWEVGSRQLRYSVSEEAKHGTFVGRIAQDLGLELAELV
PRLFRVASKTHGDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVDRPLQVFHVD
VEVKDINDNPPVFPMTVKTIRFPESRLLNSRFPLEGASDADIGVNALLSYKLSSSEFFFL
DIQTNDELSESLSLVLGKSLDREETAEVNLLLVATDGGKPELTGTVQILIKVLDVNDNEP
TFAQSVYKVKLLENTANGTLVVKLNASDADEGSNSEIVYSLGSDVFSTIQTKFTIDPSSG
EIRTMGKLDYEEAKSYEIQVTATDKGTPSMSGHCKISLKLVDINDNTPEVSITSLSLPIS
ENASLGTVIALITVSDRDSGTNGHVTCSLTPHVPFKLVPTFKNYYSLVLDNSLDRESVSA
YELVVTARDGGSPSLWATASLSVQVADVNDNAPTFAQPEYTVFVKENNPPGCHIFTVSAW
DVDAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDREELELLQFQVSARDG
GVQSLSSNVTLQVFVLDENDNAPALLPPRAGTAAGAVSELVPWSVGAGYVVAKVRAVDAD
SGYNAWLSYELQLGTGSARIPFRVGLYTGEISTTRALDETDSPRHRLLVMVKDHGEPTLT
ATATVLVSLVESGQAPKASSRAWVGAAGSEATLVDVNVYLIIAICAVSSLLVLTVLLYTA
LRCSVPPTEGARVPGKPTLVCSSAVGSWSYSQQRRQRVCSGEDPPKTDLMAFSPSLSQGP
DSTEERQLSESEYVGKIWNFNLQIQLAS
Download sequence
Identical sequences ENSMMUP00000019124 ENSMMUP00000019124 9544.ENSMMUP00000019124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]