SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019126 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019126
Domain Number 1 Region: 442-568
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-28
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 229-352
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-28
Family Cadherin 0.00069
Further Details:      
 
Domain Number 3 Region: 342-446
Classification Level Classification E-value
Superfamily Cadherin-like 1.36e-24
Family Cadherin 0.0025
Further Details:      
 
Domain Number 4 Region: 126-233
Classification Level Classification E-value
Superfamily Cadherin-like 6e-23
Family Cadherin 0.0031
Further Details:      
 
Domain Number 5 Region: 558-669
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 6 Region: 29-108
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000257
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019126   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000020434
Sequence length 776
Comment pep:known chromosome:MMUL_1:6:137227199:137410997:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000020434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVYSRRESPGSRLLLLWLLLVYWKAGSGQLHYSIPEEAKHGTFVGRIAQDLGLELAELVP
RLFRVASKGRRDLLEVNLQNGILFVNSRIDREELCRRSAECSIHLEVIVDRPLQVFHVEV
AVKDINDNPPRFSRQEQRLFILESRMPDSRFPVEGASDLDIGANAQLRYRLNPNEYFDLD
VKTNEEETHFLELVLRKSLDREETQEHRLLVIATDGGQPELTGTVQLLINVLDANDNAPE
FDKSIYNVRLLENAPSGTLVIKLNASDADEGINKDIGYFFSNLVLDDVKSKFIINSNTGE
IKVKGELDYEVCNSYEINIDAMDKSAFPLTGHCKVVVKLLDVNDNTPEMAITSLFLPVKE
DAPVSTVIALITVSDRDSGANGQVTCSLMPHVPFKLVSTFKNYYSLVLDSALDRESVSAY
ELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQSEYTVFVKENNPPGCHIFTVSAWD
ADAQENALVSYSLVERRVGERALSSYVSVHAQSGKVYVLQPLDHEQLELLQFQVSARDAG
VPPLGSNVTLQVFVLDENDNAPALLAPRVGGTGGAVSELVPWSVGAGQVVAKVRAVDPDS
GYNAWLSYELQPEPGSARIPFRVGLYTGEISTTRSLDETEAPRHRLLVLVKDHGEPALTA
TATVLVSLVESGQAPKASSRASAGAVGPEAALVDVNVYLIIAICAVSSLLVLTLLLYTAL
RCSAPPTEVVCTRGNPTLVCSSAVGSWSCSQQRRERVCSAEAPPKMDLMAFSPSLP
Download sequence
Identical sequences ENSMMUP00000019126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]