SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019127 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019127
Domain Number 1 Region: 239-364
Classification Level Classification E-value
Superfamily Cadherin-like 9.91e-32
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 452-578
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-29
Family Cadherin 0.0026
Further Details:      
 
Domain Number 3 Region: 353-456
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-24
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 136-243
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-22
Family Cadherin 0.0063
Further Details:      
 
Domain Number 5 Region: 568-679
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-16
Family Cadherin 0.0033
Further Details:      
 
Domain Number 6 Region: 39-118
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000614
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019127   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000020435
Sequence length 958
Comment pep:known chromosome:MMUL_1:6:137233241:137409920:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000020435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIKQEVFDMVFTLEDRLGKQCLLLPFLLLAAWKVGSGQLHYSVPEEAKHGTFVGRIAQD
LGLELAELVPRLFRMASKNHEDLLEVNLQNGILFVNSRIDREELCGRSAECSIHLEVIVD
RPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASDADVGSNSVLTYK
LSSSEYFGLDVKINSDDSKQIGLILRKSLDREDAPAHNLFLTATDGGKPELTGTVHLLVT
VLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMVID
HFSIDRNTGEIVIRGNLDFEQVNLYKIRVDATDKGHPPMAGHCTVLVRILDKNDNVPEIT
LTSLSLPVREDAQFGTVIALISVNDLDSGVNGQVTCSLTPHVPFKLVSTFKNYYSLVLDS
ALDRENVSAYELVVTARDRGSPSLWATASVSVGVADVNDNAPAFTQSEYTVFVKENNPPG
CHIFTVSARDADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEEVELL
QFQVSARDAGVPPLGSNVTLQVFVLDENDNAPVLLAPRVGGTGGAVSELLPRSVGVGQVV
AKVRAVDADSGYNAWLSYELQPVASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLV
KDHGEPTLTATATVLVSLVENGQAPKASSRMSVGAAGPEAALVNVNVYLIIAICSVSSLL
VLTLLLYTALRCSAPPAEGACTAGKSTLVCSSAVGSWSYSQQRRQRVCSGEGPPKMDLMA
FSPSLSPCPVMGRAENQALNEDHDAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGP
GGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPG
SPAIISIRQEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences ENSMMUP00000019127 XP_014996282.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]