SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019135 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019135
Domain Number 1 Region: 245-366
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-32
Family Cadherin 0.00058
Further Details:      
 
Domain Number 2 Region: 457-584
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 142-249
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-25
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 358-461
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-20
Family Cadherin 0.0092
Further Details:      
 
Domain Number 5 Region: 573-682
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-20
Family Cadherin 0.0058
Further Details:      
 
Domain Number 6 Region: 40-140
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000286
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019135   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000020444
Sequence length 1007
Comment pep:known chromosome:MMUL_1:6:137366464:137410997:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000020444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQAGTRPAATEHSRLRRPMPWLLLLPLRLLLLLLLPGPAASQLRYSVPEEQTPGALVGN
VARALGLELRRLGPGCLRINHLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLS
LEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGAN
SVQTYELSPSEHFELDLKPLQENSKVLELVLRKGLDREQAALHHLVLTAVDGGIPARSGT
AQISVRVLDTNDNSPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYT
SDRERQLFSIDASTGEVRVIGGLDYEEASSYQIYVQATDRGPVPMAGHCKVLVDIVDVND
NAPEVVLTDLYSPVPENATPNTIVAVLSVNDQDSGPNRKVSLGLEATLPFRLNGFGNSYT
LVVSGPLDRERVAVYNITVTATDGGIPQLTSQRTLKVEISDINDNPPSFLEDSYSIYIQE
NNLPGVLLCTVQATDPDEKENAEVTYSLLEREIQGLPVTSYVSINSASGSLYAVNSFDYE
KFREFFVTVEAQDKGSPPLSSTVTANVYVVDMNDHAPHILYPTSTNSSAAFEMVPRTAPA
GYLVTKVIAMDSDSGQNAWLFYHLAQTSDLDLFKVELHTGEIRTTRKMGDESGSTFNLTV
VVRDNGEPSLSASVAITVAVVDRVSKILPDTQRHVKSPRTYSEITLYLIIALSTVSFIFL
LTIIILSIIKCYRYTAYGTACCGGFCGVRERCPAELYKQANNNIDARIPHGLKVQPHFIE
VRGNGSLTKTYCYKACLTAGSGSDTFMFYNTGAQTGPGPSGAQAAVTDSRNLTGQSGQSA
GNLIILKNEAISQNEPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVS
SATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEP
TNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences A0A2K5XAY4 A0A2K6DA37 F7GRQ8
XP_014996277.1.72884 9544.ENSMMUP00000019135 ENSMMUP00000034003 ENSMMUP00000019135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]