SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019137 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019137
Domain Number 1 Region: 440-573
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-28
Family Cadherin 0.0028
Further Details:      
 
Domain Number 2 Region: 235-340
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-27
Family Cadherin 0.00077
Further Details:      
 
Domain Number 3 Region: 127-234
Classification Level Classification E-value
Superfamily Cadherin-like 8.11e-27
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 340-444
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-19
Family Cadherin 0.0038
Further Details:      
 
Domain Number 5 Region: 556-665
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 6 Region: 29-98
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019137   Gene: ENSMMUG00000014574   Transcript: ENSMMUT00000020446
Sequence length 818
Comment pep:known_by_projection chromosome:MMUL_1:6:137451008:137453464:1 gene:ENSMMUG00000014574 transcript:ENSMMUT00000020446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGARRKSLQSRQVGSLLIFLCVSVGGATTIRYSVAEEMESGSFVANVAKDLGLEVGKLA
ARRARLVSEGNKMHFRLHRKTGDLFVKEKLDRESLCGKADPCVLHFEIILVEPLQSFRAE
VRVFDINDNAPVFLNKEPLLKIPESTPLGSRFPLQSAQDLDVGLNGLQNYTLSANGYFHL
HTRFRSHGPKYAELVLNKPLDREEQPEVNLTIMAVDGGSPPKSGTAHIRVVVLDVNDHVP
QFSRPVYPAQVSENSPNGSLVATVTAMDLDEGTNKAITYSLAQNPEAILKTFQIDSQTGE
VRLRGTLDFEDIETYDIDIQATDGGGLSAHSKVLVEVVDVNDNPPEVMVSSVSSPLPEDS
PPQTVVALFTIRDRDIRVGGKVTCFLREDLPFVIKPTFGNSYLLVTDRSLDREEVSGYNI
TLVAMDTGPPSLSAETMIEVLISDVNDNPPIFREDSYILTVRENNSPAVFIGQVHAEDLD
LGENAQITYSLLPPKNGDLSVFAYISINSDNGKLYALRTMDYEAIQDFQFVVKATDGGFL
SLNSQATVRVVVLDDNDNRPMILYPLQNGTLPYNDLVPRSAEAGYLVTKVVAVDGDSGQN
SWLSYHLLKATDLGLFCVQRQNGEIRTLRQISERDPMMQKLIILIQDHGQPALSTTVSLN
ILLVDGFSEPYLQFQDPTKHSRKVNPSTKYLVISLAILSFLFLLSVTVIFIIHVYQKIKY
REKFTIQEHFYDDCNFSNNLVQGQGNGSLSQPCPYEMCSATGTGNSEFRFLKRFMPNFPF
PHATGEIKMEAGSSLPLNSERNKSRRSEGHDQVSDDYM
Download sequence
Identical sequences ENSMMUP00000019137 9544.ENSMMUP00000019137 ENSMMUP00000019137 NP_001180780.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]