SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019145 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019145
Domain Number 1 Region: 207-340
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 1-127
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-29
Family Cadherin 0.00099
Further Details:      
 
Domain Number 3 Region: 108-212
Classification Level Classification E-value
Superfamily Cadherin-like 4.06e-20
Family Cadherin 0.0064
Further Details:      
 
Domain Number 4 Region: 323-432
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-18
Family Cadherin 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019145   Gene: ENSMMUG00000019523   Transcript: ENSMMUT00000020454
Sequence length 564
Comment pep:known chromosome:MMUL_1:6:137495261:137497781:1 gene:ENSMMUG00000019523 transcript:ENSMMUT00000020454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDINDNVPEFAKLLYEVQIPEDSPIGSQVAIVSARDLDIGTNGEISYAFFQASEDIRKTF
RLSAKSGELLLRQTLDFESIQTYTVNIQATDGGGLSGTCVVFVQVMDLNDNPPELTMSTL
INQIPENLQDTLIAVFSVSDPDSGDNGRTVCSIQDDLPFFLKPSVENFYTLVISTALDRE
TRSEYNITITVTDLGTPRLKIQHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGS
VSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALRSLDYEALQAFEFRVG
ATDRGSPELSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAV
DGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAAKHRLVVLVKDNGEPPR
SATATLHVLLVDGFSQPYLPLPEAAPAQAQADSLTVYLVVALASVSLLFLLSVLLFVAVR
LCRRSRAASVGRCSVPEGPFPGHLVDVSGTETLSQSYQYEVCLTGGSGTNEFKFLKPIIP
NFVAQGAERVNEANPSFRKSFEFS
Download sequence
Identical sequences ENSMMUP00000019145 9544.ENSMMUP00000019145 ENSMMUP00000019145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]