SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019232 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019232
Domain Number 1 Region: 41-119
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000139
Family Nucleotide and nucleoside kinases 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019232   Gene: ENSMMUG00000030606   Transcript: ENSMMUT00000020552
Sequence length 156
Comment pep:novel chromosome:MMUL_1:9:42923354:42927457:1 gene:ENSMMUG00000030606 transcript:ENSMMUT00000020552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKHRKKNSGPKAEKKRDEEDARKRNPKAFAVQSAVRMARSFHRNRTQDLKTKKHHIPVVD
RTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTIVSGKKRRLTIIECG
CDINMMIDLAKVADLVRIIVIISDTVDMIELMIIIM
Download sequence
Identical sequences 9544.ENSMMUP00000019232 ENSMMUP00000019232 ENSMMUP00000019232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]