SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019291 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019291
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily vWA-like 4.79e-31
Family Integrin A (or I) domain 0.00084
Further Details:      
 
Domain Number 2 Region: 947-1146
Classification Level Classification E-value
Superfamily vWA-like 7.97e-24
Family Integrin A (or I) domain 0.0075
Further Details:      
 
Domain Number 3 Region: 509-686
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-23
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 4 Region: 145-318
Classification Level Classification E-value
Superfamily Fibronectin type III 3.22e-20
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 5 Region: 692-864
Classification Level Classification E-value
Superfamily Fibronectin type III 3.95e-20
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 6 Region: 333-500
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-17
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 7 Region: 2797-2856
Classification Level Classification E-value
Superfamily BPTI-like 2.27e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0013
Further Details:      
 
Domain Number 8 Region: 870-954
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000283
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019291   Gene: ENSMMUG00000014699   Transcript: ENSMMUT00000020617
Sequence length 2865
Comment pep:known_by_projection chromosome:MMUL_1:2:87883007:87912661:1 gene:ENSMMUG00000014699 transcript:ENSMMUT00000020617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTEFSLDALGSGGDVIRAIRELSYKGGNTRTGAAILHVADRVFLPQLARPGVPKVCILIT
DGKSQDLVDTAAQKLKGQGVKLFAVGIKNADPEELKRVASQPTSEFFFFVNEFSILRTLL
PLVSRRVCTTAGGMPVTRPLDDSTSAPRDLVLSEPSSQSLRVQWTAASGPVTGYKVQYTP
LTGLGQPLPSERQEVNIPAGETSVWLQGLRPLTEYQVTVVALYANSIGEAVSGTARTTAL
EGPELTIQNTTAHSLLVAWRSVSGATGYRVTWRVLSGGPTQQQELGPGQGSVLLHDLEPG
TDYEVTISTLFGHSVGPTASLTARTDTSVEQTLRPVILGPTSILLSWNLVPEARGYRLEW
RRETGLEPPQKVVLPSDVTRYQLDGLQPGTEYRLTLYTLLEGREVATPATVVPTGPELPV
GPVMDLQATELPGQRVRVSWSPVPGATQYRIIVRSTQGVERILMLPGSQTAFDLDDVQAG
LSYTVRVSARVGSREGSASVLTVRREPETPLAVPGLRVVVSDATRVRVAWGPVPRASGFR
ISWSTGSGPESSQTLPPDSTVTDITGLQPGTAYQVAVSVLRGREEGPAAVIVARTDPLGP
VRTVHVTQASSSSVTITWTRVPGATGYRVSWHSAHGPEKSQLVSGEATVAELDGLEPDTE
YTVHVRAHVAGVDGPPASVVVRTAPEPVGRVSRLQILNASSDVLRITWVGVTGATAYRLA
WGRSEGGPMRHQILPGNTDSAEIRGLEGGVSYSVRVTALVGDREGTPVSIVVTTPPEAPP
ALGTLHVVQRGEHSLRLRWEPVPGVQGFLLRWQPEGGQEQSRVLGPELNSYHLDGLEPAT
QYRVRLSVLGPAGEGPSADMTVRTESPRVPSTELRVVDTSIDSVTLAWTPVSRASSYILS
WRPLRGPGQVPGAPQTLPGISSSQRVTGLEPGVSYIFSLTPVLDGVQGPEASITQAPVCP
RGLADVVFLPHATQDNAHRAEATRRVLERLVLALGPLGPQAVQVGLLSYSHRPSPLFPLN
GSYDLGIILQRIRDMPYMDPSGNNLGTAVVTAHRYVLAPDAPGRRQHVPGVMVLLVDEPL
RGDIFSPIREAQAAGLKVVMLGMAGADPEQLRRLVPGMDSVQTFFAVDDGPSLDRAVSGL
AAALCQASFTTQPRPEPCPVYCPKGQKGEPGEMGLRGQVGPPGDPGLPGRTGAPGPQGPP
GSAIAKGERVTGADGRPGSPGRPGTPGTPGAPGLKGSPGLPGPRGEPGEQGPRGPKGEPG
APGQITGGEGPGLPGRKGDPGPSVRSMGLHLILCLLHHGPPGPRGPLGDPRPRGPPWLPG
TAMKGDKGDRGERGPPGPGEGGIAPGEPGLPGLPGSPGPQGPVGPPGEKGEKGDSEDGAP
GLPGQPGPLLFHQGERGPPGPAGSRPPPQPLALPISPIPTHLHSSSLSFLQGLPGVAGRP
GAEGPEGPPGPTGRQGEKGEPGRPGDPAVVGPAVAGPKGEKGDVGPAGPRGATGVQGERG
APGLVLPGDPGPKGDPGDRGPIGLTGRAGPPGDSGPPGEKGDPGRSGPPGPVGPRGRDGE
VGEKGDEGPPGDPGLPGKAGERGLRGAPGVRGPVGEKGNQGDPGADGQNGSPGPSGSKGD
RGEPGPPGLPGRLVDIGPGAREKGEPGDRGQEGPRGPKGDPGLPGAPGDRGIDGLRGPPG
PQGDPGVRGPAGEKGDRGPPGLDGRSGLDGKPGASGPPGLNGAAGKAGDPGRDGLPGLRG
EQGPPGPSGSPGLPGKPGEDGKPGLNGKNGEPGDPGEDGRKGEKGDSGAPGREGRDGPKG
ERGVPGILGPQGPPGLPGPVGPPGQGFPGVPGGTGPKGDRGETGSKGEHGLPGERGLRGE
PGSVPNVDRLLETAGIKVSALREIVETWDESSGSFLPVPERRRGPKGDPGERGSPGKEGP
IGFPGERGLKGDRGDPGPQGPPGLALGERGPPGPPGLAGEPGKPGIPGLPGRAGGVGEAG
RPGERGERGEKGERGEQGRDGPPGLPGSPGLPGPPGPKVSVDGPGPALSGEQGPPGLKGA
KGEPGSDGDRGPKGDRGVPGIKGDRGEPGPRGQDGNLGLPGERGVAGPEGKPGLQGPRGP
PGPAGGHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPGPTGAVGLPGPPGPS
GLVGPQGSPGLPGQVGETGKPGAPGRDGAGGKDGDRGSPGVPGSPGLPGPVGPKGEPGPT
GAPGQAVVGLPGAKGEKGAPGGLAGDLVGEPGAKGDRGLPGPRGEKGEAGRAGEPGDPGE
DGQKGAPGPKGFKGDPGVGVPGSPGLPGPPGVKGDLGLPGPPGAPGVVGFPGQTGPRGEM
GQPGPSGERGLAGPPGREGVPGPLGPPGPPGSVGPPGASGLKGDKGDPGAGLPGPRGERG
EPGVRGEDGRPGQEGPRGLTGPPGSRGERGEKGDVGTAGLKGDKGDSAVILGPPGPRGAK
GDTGERGPRGLDGDKGPRGDSGDPGDKGSKGEPGDKGSAGSPGLRGLPGPQGQPGAAGIP
GDPGSPGKDGVPGIRGGKGDVGFMGPRGLKGERGVKGACGLDGEKGDKGEAGPPGRPGLA
GHKGEMGEPGVPGQSGAPGKEGLIGPKGDRGFDGQPGPKGDQGEKGERGTPGIGGFPGPR
GSDGSAGSPGPPGSVGPRGPEGLQGQKGERGPPGERVVGAPGAPGAPGERGEQGRPGPAG
PRGEKGEAALTEDDIRGFVRQEMSQHCACQGQFIASGSRPLPSYAADTAGSQLHAVPVLR
VSHAEEEERVPPEDDEYSEYSEYSVEEYQDPEAPWDSDDPCSLPLDEGSCTAYTLRWYHR
AVPGSTEACHPFVYGGCGGNANRFGTREACERRCPPRVAQSQGIG
Download sequence
Identical sequences 9544.ENSMMUP00000019291 ENSMMUP00000019291 ENSMMUP00000019291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]