SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019303 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019303
Domain Number 1 Region: 386-415,495-574
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000667
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019303   Gene: ENSMMUG00000031754   Transcript: ENSMMUT00000020629
Sequence length 591
Comment pep:known chromosome:MMUL_1:2:87837886:87847561:1 gene:ENSMMUG00000031754 transcript:ENSMMUT00000020629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVMVGSVTESLAPQTLNDSTINETTRDAERVRVASTLSVLVGLFQVGLGLIHFGFLVTY
LSEPLVRGYTTAAAVQVFVSQLKYVFGLHLSSHSGPLSLIYTVLEVCRKLPQSKVSTVVT
AAVAGVVLLVVKLLNDKLRRQLPMPIPGELLMLIGATGISYGMGLKHIFGVDVVGNISAG
LVPPVAPNTQLFSKLVGSAFTIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLI
GGIFQCFPVSCSMSRSLVQESTGGNSQVAGAISSLFILLIIVKLGELFRDLPKAVLAAII
IVNLKGMLRQLSDVCSFWKANRADLLIWLVTFAATILLNLDLGLMVSVVFSLLLVVVRTQ
MPHYSILGQVPDTDIYRDVAEYSEAKEVPGVKVFRSSATVYFANADFYSDALKQRCGVDV
DFLISQKKKLLKKREQLKLKQLQKEKKLQKQAGPLLSACLAPQQVSPGDKMEDATANGQE
DSKAPDGSTLKALGLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFRDIEVEVYMAAC
HSPVVSQLEAGHFFDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Download sequence
Identical sequences ENSMMUP00000019303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]