SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019308 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019308
Domain Number 1 Region: 535-564,662-741
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000141
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019308   Gene: ENSMMUG00000031754   Transcript: ENSMMUT00000020634
Sequence length 758
Comment pep:known chromosome:MMUL_1:2:87837898:87847561:1 gene:ENSMMUG00000031754 transcript:ENSMMUT00000020634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLADASGPRDTQALLSATQAVELRRRDYHMERPLLNQEHLEELGRWGSAPRTRQWRTWL
QCSHARARALLLQHLPVLVWLPRYPVRDWLLGDLLSGMSVAIMQLPQGLAYALLAGLPPV
FGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLAPQTLNDSTINETTRDAER
VRVASTLSVLVGLFQVGLGLIHFGFLVTYLSEPLVRGYTTAAAVQVFVSQLKYVFGLHLS
SHSGPLSLIYTVLEVCRKLPQSKVSTVVTAAVAGVVLLVVKLLNDKLRRQLPMPIPGELL
MLIGATGISYGMGLKHIFGVDVVGNISAGLVPPVAPNTQLFSKLVGSAFTIAVVGFAIAI
SLGKIFALRHGYRVDSNQELVALGLSNLIGGIFQCFPVSCSMSRSLVQESTGGNSQVAGA
ISSLFILLIIVKLGELFRDLPKAVLAAIIIVNLKGMLRQLSDVCSFWKANRADLLIWLVT
FAATILLNLDLGLMVSVVFSLLLVVVRTQMPHYSILGQVPDTDIYRDVAEYSEAKEVPGV
KVFRSSATVYFANADFYSDALKQRCGVDVDFLISQKKKLLKKREQLKLKQLQKEKKLQKQ
AASSKGASVSINVNTSLEDMRSNNVEDCKVMVSPGDKMEDATANGQEDSKAPDGSTLKAL
GLPQPDFHSLILDLGALSFVDTVCLKSLKNIFHDFRDIEVEVYMAACHSPVVSQLEAGHF
FDASITKKHLFASVHDAVTFALQHPRPVPDSPVSVTRL
Download sequence
Identical sequences ENSMMUP00000019306 9544.ENSMMUP00000019308 ENSMMUP00000019308 XP_005547094.1.63531 XP_011737552.1.29376 XP_014986472.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]