SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019312 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019312
Domain Number 1 Region: 1496-1717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.34e-42
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 644-749
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-28
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 539-651
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 955-1067
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00086
Further Details:      
 
Domain Number 5 Region: 322-425
Classification Level Classification E-value
Superfamily Cadherin-like 3e-25
Family Cadherin 0.00094
Further Details:      
 
Domain Number 6 Region: 1055-1172
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 852-954
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 1734-1944
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-24
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 9 Region: 427-537
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-24
Family Cadherin 0.00096
Further Details:      
 
Domain Number 10 Region: 750-850
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.00086
Further Details:      
 
Domain Number 11 Region: 1435-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000186
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 12 Region: 1163-1265
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000614
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 1978-2024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000312
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 1942-1976
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 2072-2111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019312
Domain Number - Region: 2100-2174
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00418
Family Hormone receptor domain 0.0057
Further Details:      
 
Domain Number - Region: 1414-1440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00779
Family EGF-type module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019312   Gene: ENSMMUG00000014707   Transcript: ENSMMUT00000020638
Sequence length 3307
Comment pep:known chromosome:MMUL_1:2:87811113:87835182:1 gene:ENSMMUG00000014707 transcript:ENSMMUT00000020638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMARRPPWRGLGGRSTPILLLLLLSLFPLSQEELGGGGHQGWDPGLAATTGLRPHIGGGA
LALCPESPGVREDGGPGLGVREPVFVGLRGERQSSRNSRGPPEQPNEELRIEHGVQPLGS
RERETGQGPGSMLHWRPEISSCGRTGPLQRGSLSPGALSPGVPGSGNSSPLPSDFLVRHH
GPKPVSSQRNAGTGARKRVGTARCCGELWAIGSKSQGERATTSGAERTAPRRNCLPGASG
SGPELDSAPRTARTAPAPGSAPRESRTAPKPAPERMRSRGLFRRRFLPQRPGPRPPGIPA
RPEARKITSANRARFRRAANRHPQFPQYNYQTLVPENEAAGTAVLRVVAQDPDAGEAGRL
VYSLAALMNSRSLELFSIDPQSGLIRTAAALDRESMERHYLRVTAQDHGSPRLSATTMVA
VTVADRNDHSPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARA
AAAAAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDEND
NAPQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTG
EIQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHIPIFVSTPFQVSV
LENAPLGHSVIHIQAVDADHGENARLEYSLTGVASDTPFVINSATGWVSVSGPLDRESVE
HYFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDAAVGTSVVSVTA
VDRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHD
HCYVHINITDANTHRPVFQSAHYSVSVNEDRPVGSTIVVISASDDDVGENARITYLLEDN
LPQFRIDADSGAITLQAPLDYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQ
FVASHYTGLVSEDAPPFTSVLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVR
TVRRLDREAVSVYELTAYAVDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENS
IVGSVVAQITAVDPDEGPNAHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYVI
VVQATSAPLVSRATVHVRLIDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDP
DVSDHLFYSFERGNELQLLVVNQTSGELRLSRKLDNNRPLVASMLVTVTDGLHSVTAQCV
LRVVIITEELLANSLTVRLENMWQERFLSPLLGHFLEGVAEVLATPAEDVFIFNIQNDTD
VGGTVLNVSFSALAPRGAGAGAAGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCL
REPCENYMKCVSVLRFDSSAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCY
SNPCRNGGACARREGGYTCVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCTDAPNGGFRC
QCPAGGAFEGPRCEVAARSFPPSSFVMFRGLRQRFHLTLSLSFATVQQSGLLFYNGRLNE
KHDFLALELVAGQVRLTYSTGESNTVVSPTVPGGLSDGQWHTVHLKYYNKVGTSLASGMR
GVAVLSVDDCDVAVALQFGAEIGNYSCAAAGVQTSSKKSLDLTGPLLLGGVPNLPENFPV
SHKDFIGCMRDLHIDGRRMDMAAFVANNGTMAGCQAKLHFCDSGPCKNSGFCSERWGGFS
CDCPVGFGGKDCRLTMAHPHHFRGNGTLSWNFGSDMAVSVPWYLGLAFRTRATQGVLMQM
QAGPHSTLLCQLDRGLLSVTVTRGSGRASHLLLDQVTVSDGRWHDLRLELQEEPGGRRGH
HVLMVSLDFSLFQDTMAVGSELQGLKVKQLHVGGLPPGSAEEAPQGLVGCIQGVWLGSTP
SGSPALLPPSHQVNAEPGCVMTNACASGPCPPHADCRDLWQTFSCICRPGYYGPGCVDAC
LLNPCQNQGSCRHLPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPCNCDVH
KGFDPNCNKTNGQCHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGR
QCNSCDSPFAEVTASGCRVLYDACPKSLRSGVWWPQTKFGVLATVPCPRGALGAAVRLCD
EAQGWLEPDLFNCTSPAFRELSLLLDGLELNKTALDTMEAKKLAQRLREVTSHTDHYFSQ
DVRVTARLLAHLLAFESHQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAALGQRAP
GGSPGSAGLVRHLEEYAATLARNMELTYLNPMGLVTPNIMLSIDRMEHPSSPRGARRYPR
YHSNLFRGQDAWDPHTHVLLPSQSPRPSPSEVLPTSSSMENSTTSSVVTPPAPPEPEPGI
SIIILLVYRTLGGLLPAQFQAERRGARLPQNPVMNSPVVSVAVFHGRNFLRGVLESPISL
EFRLLQTANRSKAICVQWDPPGLVEQHGVWTARDCELVHRNGSHARCRCSRTGTFGVLMD
ASPRERLEGDLELLAVFTHVVVAVSVAALVLTAAVLLSLRSLKSNVRGIHANVAAALGMA
ELLFLLGIHRTHNQLVCTAVAILLHYFFLSTFAWLFVQGLHLYRMQVEPRNVDRGAMRFY
HALGWGVPAVLLGLAVGLDPEGYGNPDFCWISVHEPLIWSFAGPIVLVIVMNGTMFLLAA
RTSCSTGQREAKKTSALTLRSSFLLLLLVSASWLFGLLAVNHSILAFHYLHAGLCGLQGL
AALLLFCVLNADARAAWTPACLGRKAAPEEARPAPGTGPGAYNNTALFEESGLIRITLGA
STVSSVSSARSGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHSLQAHAGPTDLDVAMFH
RDAGADSDSDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSERLLTHPKDVDG
NDLLSYWPALGECEAAPCALQTWGSERRLGLDTNKDAANNNQPDPALTSGDETSLGRAQR
QRKGILKNRLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRIYAGRGTGSLSQPASR
YSSREQLDLLLRRQLSRERLEEAPDPVPHPLSRPGSQECMDAAPGRLEPRDRGSTLPRRQ
PPRDYPGAMAGRFGSRDALDLGAPREWLSTLPPPRCTRDLDPQPPPLSLSPQRQLSRDPL
LPSRPLDSLSRSSNSRERLDQVPSRHPSREALGPPPQLLRAREDPVSGPSHGPSTEQLDI
LSSILASFNSSALSSVQSSSTPSGPHTTATPSATASVLGPSTPRSATSHSISELSPDSEV
PRSEGHS
Download sequence
Identical sequences ENSMMUP00000019312 ENSMMUP00000019312 9544.ENSMMUP00000019312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]