SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019336 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019336
Domain Number 1 Region: 25-113
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 218-359
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-19
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 135-230
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000228
Family Cadherin 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019336   Gene: ENSMMUG00000014733   Transcript: ENSMMUT00000020663
Sequence length 410
Comment pep:known chromosome:MMUL_1:9:65352016:65490068:-1 gene:ENSMMUG00000014733 transcript:ENSMMUT00000020663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTKSEFTVEFSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVN
ATDPDLGAGGSVLYSFQPPSQFFAIDSARGIITVIRELDYETTQAYQLTVNATVSLHAGA
PASNGAFQWDTDPGTTVRIITAIDQDKGRPRGIGYTIVSGNTNSIFALDYISGALTLNGL
LDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVIDINDNAPEFNSSEYSVAIT
ELAQVGFALPLFIQVVDKDEGLNSMFEVYLVGNNSHHFIISPTSVQGKADIRIRVAIPLD
YETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISLYENVTVGTSVL
TVLVSPRSPTGLLSSPGPTAVRHPEGFCPRDLGNQGRRRPQIPELCLLAY
Download sequence
Identical sequences ENSMMUP00000019336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]