SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019337 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019337
Domain Number 1 Region: 294-400
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-26
Family Cadherin 0.00075
Further Details:      
 
Domain Number 2 Region: 81-186
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 187-294
Classification Level Classification E-value
Superfamily Cadherin-like 2e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 1-87
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-16
Family Cadherin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019337   Gene: ENSMMUG00000014733   Transcript: ENSMMUT00000020664
Sequence length 465
Comment pep:known chromosome:MMUL_1:9:65288960:65318276:-1 gene:ENSMMUG00000014733 transcript:ENSMMUT00000020664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATDEDSPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAK
DAGNPPLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREY
GQESIIYSLEGSAQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATV
NITLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFY
SLNGTTGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLRATSSATVFVNLLDLN
DNDPTFQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSS
GVVVTTTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHAGAGCERRDAHLLPGRVQRV
RVRGCAARVPSGLAELHRQRRGPQCRAQLFHHRWQRGWEVQRGLP
Download sequence
Identical sequences ENSMMUP00000019337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]