SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019338 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019338
Domain Number 1 Region: 469-586
Classification Level Classification E-value
Superfamily Cadherin-like 9.71e-31
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 574-710
Classification Level Classification E-value
Superfamily Cadherin-like 7.36e-28
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 256-361
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 4 Region: 362-469
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 5 Region: 173-262
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-17
Family Cadherin 0.0093
Further Details:      
 
Domain Number 6 Region: 45-99
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000123
Family Cadherin 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019338
Domain Number - Region: 4-51
Classification Level Classification E-value
Superfamily Cadherin-like 0.004
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019338   Gene: ENSMMUG00000014733   Transcript: ENSMMUT00000020665
Sequence length 802
Comment pep:known chromosome:MMUL_1:9:65284936:65352856:-1 gene:ENSMMUG00000014733 transcript:ENSMMUT00000020665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRPIFSQPLYNISL
YENVTVGTSVLTVLATDNDAGTFGEVNYFFSDDPDRALDWKLEPMGTVAGLTLIVAQPCT
RGASRVPGPGQDPGLDHPIKELSAGPAFPSLAAAHPLLVLSLLQAHGSCLPSSFQATDED
SPPNNQITYSIVSASAFGSYFDISLYEGYGVISVSRPLDYEQISNGLIYLTVMAKDAGNP
PLNSTVPVTIEVFDENDNPPTFSKPAYFVSVVENIMAGATVLFLNATDLDRSREYGQESI
IYSLEGSAQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGVGHNQKTGIATVNITLL
DINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNGT
TGKIRTTHAMLDRENPDPHEAELMRKIVVSVTDCGRPPLRATSSATVFVNLLDLNDNDPT
FQNLPFVAEVLEGIPAGVSIYQVVAIDLDEGLNGLVSYRMPVGMPRMDFLINSSSGVVVT
TTELDRERIAEYQLRVVASDAGTPTKSSTSTLTIHVLDVNDEMPTFFPAVYNVSVSEDVP
REFRVVWLNCTDNDVGLNAELSYFITGGNVDGKFSVGYRDAVVRTVVSLDRETTAAYMLI
LEAIDNGPVGKRHTGTATVFVTVLDVNDNRPIFLQSSYEASVPEDIPEGHSIVQAALASP
SISPAPPRRAFQCRGEKEMSQFPGKELRREPGPSKAQNRAAFTEPLAEAPLLGSKQAQEE
RAPLPREQAQQLQDSEGERGGP
Download sequence
Identical sequences ENSMMUP00000019338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]