SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019358 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019358
Domain Number 1 Region: 61-126
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.7e-18
Family Ribosomal protein S18 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019358   Gene: ENSMMUG00000014749   Transcript: ENSMMUT00000020686
Sequence length 269
Comment pep:known_by_projection chromosome:MMUL_1:4:43578182:43595592:-1 gene:ENSMMUG00000014749 transcript:ENSMMUT00000020686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAFKGLVSAYGGLLRGLLAGPAATSWSRLPARGFREVVEIQEGKTTIIEGRLTATPKGS
PNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVK
MAHRAGRRSWGPRGAEGRRRSLPTRLPHVSAPPGRKEDIQSVNYTPHPMPTSPLPWAFPL
APSELQRELQRLSHLPHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGP
RWNKVCMPVGSPLLRDNVCYSRTPWKLYH
Download sequence
Identical sequences ENSMMUP00000019358 ENSMMUP00000019358 9544.ENSMMUP00000019358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]