SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019596 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019596
Domain Number 1 Region: 978-1194
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-30
Family Kelch motif 0.02
Further Details:      
 
Domain Number 2 Region: 1255-1376
Classification Level Classification E-value
Superfamily Kelch motif 0.0000000000222
Family Kelch motif 0.013
Further Details:      
 
Domain Number 3 Region: 685-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000377
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 548-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 5 Region: 637-685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019596
Domain Number - Region: 1726-1776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 14-83
Classification Level Classification E-value
Superfamily Kelch motif 0.000288
Family Kelch motif 0.046
Further Details:      
 
Domain Number - Region: 1654-1689
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000374
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 1820-1855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00186
Family Laminin-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019596   Gene: ENSMMUG00000014932   Transcript: ENSMMUT00000020949
Sequence length 2318
Comment pep:known_by_projection chromosome:MMUL_1:19:48658497:48700181:1 gene:ENSMMUG00000014932 transcript:ENSMMUT00000020949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVYGGNVHTHYQEEKCYEDGIFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAA
VLGGSVLLVAGGYSGRPRGDLMAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSW
CQGACQAAPPPGTPLGACPAASCLGLGRLLGDCQACLAFSSPTAPPRGPGTLGWCVHNES
CLPRPEQARCRGEQISGTVGWWGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDK
EEVGRWVAHQEKETRQLQRPGSARLFPLPGRDHKYAVEIRGQLNGSAGPGHSELTLLWDR
TGVPGGSEISFFFLEPYRSSACTSYSSCLGCLADQGCGWCLTSASCHLRQGGAHCRDDRA
GGSLLVLVPTLCPLCEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGAIKSPDEC
PPLCNQRLTCEDCLANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSC
DGFLTCHECLQSHECGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPAR
WAYARCPDVDECRLGLARCHPRATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGV
CSGPPDFTCVCDLGWTSDLPLPTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWT
WGEHCERCRPGSFGNATGSRGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCS
PGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVV
SATEELQPCAPGTLCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAF
CGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDG
AAGAGLCRCPQGWAGPHCRMALCPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDG
GQLVWETLMDSRLSADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSE
RRWTQMLAGAEDGGPGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQW
RQEKAPQTVELPAVAGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSG
TPPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKG
DCVRNVGGSSQGVWVPREQPGSWGFRELRKEMVLWAALAGTGGFLEEISPHLKEPRPRLF
HASALLGDTMVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPVEESVAHAVA
AVGGRLYISGGFGGVALGRLLALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHR
LGCGGSPCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEGACIG
RNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILS
VQPTYDWTCFSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSS
SLQQCLSPSYLPLRCMAGGCGRLLRGPESCSLGCAQATQCASCLRRPHCGWCAWGGQDGG
GRCMEGGLSGPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCK
TGYTMDNVTGLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGAR
DHCLLCRNHTKGSHCEQCLPLFVGSAVGGGTCRPCHTFCRGNSHVCISKKEFEMAKGEPQ
KYSLDPEEIENWVTEGPSEDEAMCVNCQNNSYGEKCESCLQGYFLLDGKCTKCQCNGHAD
TCNEQDGTGCPCQNNTETGTCQGSSPSDRRDCYKFQCAKCRESFHGNPLGGQQCYRLISV
EQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTS
FDTFVVRVAPDTGVHTVHIQASQPPPPPPPLADGGPRGAGDPGGAGASSGPGAPAEPRVR
EVWPQGLITYVTVTEPSAVLVVHSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGT
NGSADSQGLLFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQ
EMTKMASRPFAKVTVCFPPDPTALAPAWKPAGLPPPAFRRSEPFLAPLLLTGAGGPWGPM
GGGCCPPAIPATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLR
HRLHEYCGGGGVAGGSGHGAGVGRKGLLSQDNLTSMSL
Download sequence
Identical sequences ENSMMUP00000019596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]