SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019683 from Macaca mulatta 76_1

(show help)
Strong hits

Sequence:	ENSMMUP00000019683
Domain Number 1	Region: 84-113
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.00000000000294
Family	LIM domain	0.01
Further Details:

Domain Number 2	Region: 48-80
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.0000000000677
Family	LIM domain	0.0034
Further Details:

Domain Number 3	Region: 20-48
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000000000952
Family	LIM domain	0.0091
Further Details:

Weak hits

Sequence:	ENSMMUP00000019683
Domain Number -	Region: 114-145
Classification Level	Classification	E-value
Superfamily	Glucocorticoid receptor-like (DNA-binding domain)	0.000734
Family	LIM domain	0.033
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

External link(s)	Protein: ENSMMUP00000019683 Gene: ENSMMUG00000015017 Transcript: ENSMMUT00000021053
Sequence length	155
Comment	pep:known_by_projection chromosome:MMUL_1:14:63691739:63736356:1 gene:ENSMMUG00000015017 transcript:ENSMMUT00000021053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MVLDQEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEV GSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQ RFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Download sequence
Identical sequences	A0A096MKY5 A0A2I3H6K0 A0A2I3S0D2 A0A2J8SVC3 A0A2K5D5L2 A0A2K5K415 A0A2K5MYJ7 A0A2K5QXV1 A0A2K5U6F8 A0A2K5YXD9 A0A2K6CD70 A0A2K6FZ25 A0A2K6LG10 A0A2K6NZZ8 G3R6X7 U3CQ04 U6CNF0 ENSP00000404538 ENSMMUP00000019683 NP_001257357.1.87134 NP_001257357.1.92137 XP_001165367.2.37143 XP_003781126.1.62490 XP_005578766.1.63531 XP_009005887.1.60252 XP_009244946.1.23681 XP_010359566.1.97406 XP_011751391.1.29376 XP_011809768.1.43180 XP_011855642.1.47321 XP_011919129.1.92194 XP_012311816.1.9421 XP_012358524.1.23891 XP_014970421.1.72884 XP_015852767.1.50099 XP_017355830.1.71028 XP_017501839.1.32401 XP_017751867.1.44346 XP_018891276.1.27298 XP_019311760.1.44245 XP_021491929.1.76796 ENSP00000404538

SEARCH