SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019727 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019727
Domain Number 1 Region: 287-636
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.08e-110
Family PDEase 0.00000222
Further Details:      
 
Domain Number 2 Region: 130-280
Classification Level Classification E-value
Superfamily GAF domain-like 2.31e-40
Family GAF domain 0.000000568
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019727
Domain Number - Region: 58-98
Classification Level Classification E-value
Superfamily GAF domain-like 0.0363
Family GAF domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019727   Gene: ENSMMUG00000015051   Transcript: ENSMMUT00000021097
Sequence length 645
Comment pep:known_by_projection chromosome:MMUL_1:14:70660709:70694965:-1 gene:ENSMMUG00000015051 transcript:ENSMMUT00000021097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDALLSLGSVIDISGLQRAVKEALSAVLPRVETVYTYLLDGESRLVCEDPPHELPQEGKV
WFTDQDEHVIQHCFHYTSTVLTSTLAFQKEQKLKCECQPPRPIQKGNAHVFLDCLMTWRP
AVAQDPRHCPQALYCSIWALQQHQLELVFDGGVVDDESYEIRIPADQGIAGHVATTGQIL
NIPDAYAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDL
ATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDESTKLLHDGIQPVAAI
DSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYH
NWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLDHRGTNNSFQVASKSVLA
ALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRI
FKDLQKMAEVGYDRNNKQHHRLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDL
EKAMGNRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPEAAELYERVASNREHWT
KVSHKFTIRGLPSNNSLDFLDEEYEVPDLDGTGAPINGCCSLDAE
Download sequence
Identical sequences ENSMMUP00000019727 ENSMMUP00000019727 9544.ENSMMUP00000019727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]