SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019748 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019748
Domain Number 1 Region: 103-305
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.09e-75
Family T-box 0.00000000631
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019748   Gene: ENSMMUG00000015070   Transcript: ENSMMUT00000021121
Sequence length 743
Comment pep:known_by_projection chromosome:MMUL_1:11:115600903:115614297:-1 gene:ENSMMUG00000015070 transcript:ENSMMUT00000021121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNGAAALSLPGAL
AKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVEDDPKVHLEAKELWDQFHKRG
TEMVITKSGRRMFPPFKVRCSGLDKKAKYILLMDIIAADDCRYKFHNSRWMVAGKADPEM
PKRMYIHPDSPATGEQWMSKVVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQT
ILNSMHKYQPRFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFAQASSPAVSTV
GTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTSEEPCRDKGSPAVKAHLFAAE
RPRDSGRLDKASPDSRHSPATISSSTRGLGAEERRSPGREGAAPAKVEEARALPGKEAFA
PLTVQSDAAAAHLAQGPLPGLGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMG
PLLATVSGASTGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVPDGSSLLTTAL
PSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLSSSSVSLSPKLCAEKEAATSE
LQSIQRLVSGLEAKPDRSRSASP
Download sequence
Identical sequences A0A2K5MT14 A0A2K5X5X4 A0A2K5XDI3 A0A2K6ARE0 G7N5Q8
ENSMMUP00000019749 9544.ENSMMUP00000019748 ENSMMUP00000019748 XP_001111920.1.72884 XP_005572393.1.63531 XP_011763124.1.29376 XP_011822709.1.47321 XP_011930431.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]