SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019761 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019761
Domain Number 1 Region: 302-628
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 3.04e-32
Family N-acetylglucosaminyltransferase I 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019761   Gene: ENSMMUG00000015078   Transcript: ENSMMUT00000021135
Sequence length 660
Comment pep:known chromosome:MMUL_1:1:49126767:49136305:-1 gene:ENSMMUG00000015078 transcript:ENSMMUT00000021135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDWKPSPLIKPFGARKKRSWYLTWKYKLTNQRALRRFCQTGAVVFLLVTVIVNIKLILD
TRRAISEANEDPEPEQDYDEVLGRLEPPRRRGSGPRRVLDVEVYSSRSKVYVAVDGTTVL
EDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDE
GSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLL
KTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVL
NVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTP
ISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLY
CISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMR
MPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRNVDSLKKEA
YEVEVHRLLSEAEVLDHSKNPCEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIW
DLDVRGNHRGLWRLFRKKNHFLVVGVPSSPYSVKKPPSVTPIFLEPPPKEEGAPGAAEQT
Download sequence
Identical sequences F7GR55
XP_014994181.1.72884 XP_014994190.1.72884 ENSMMUP00000019761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]