SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019767 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019767
Domain Number 1 Region: 826-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000865
Family Laminin-type module 0.0000555
Further Details:      
 
Domain Number 2 Region: 722-773
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 3 Region: 284-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000474
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 4 Region: 882-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family Laminin-type module 0.00017
Further Details:      
 
Domain Number 5 Region: 933-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000335
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 445-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 396-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 340-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000218
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 771-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.00021
Further Details:      
 
Domain Number 10 Region: 981-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000026
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 11 Region: 1280-1525
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000608
Family Tropomyosin 0.00076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019767
Domain Number - Region: 1080-1282
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000436
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 
Domain Number - Region: 98-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00468
Family Galactose-binding domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019767   Gene: ENSMMUG00000015084   Transcript: ENSMMUT00000021141
Sequence length 1607
Comment pep:known chromosome:MMUL_1:1:187518983:187638359:-1 gene:ENSMMUG00000015084 transcript:ENSMMUT00000021141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGSQRAAPLRRRGRLWPVLAVLAAAAAGCAQAAMDECTDEGGRPQRCMPEFVNAAFNVT
VVATNTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQT
MLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSC
ENTYSKANRGFIRTGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQE
WVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECMKNEFDK
LVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG
HGGHCTNCQDNTDGAHCERCRENFFRLGNNEACSPCHCSPVGSLSTQCDSYGRCSCKPGV
MGDKCDRCQPGFHSLTEAGCRPCSCDPSGSIDECNVETGRCVCKDNVEGFNCERCKPGFF
NLESSNPRGCTPCFCFGHSSVCTNAVGYSVYSISSSFQIDEDGWRVEQRDGSEASLEWSS
ERQDIAVISDSYFPRYFIAPAKFLGKQVLSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGL
RVSVPLIAQGNSYPSETTVKYVFRLHEATDYPWRPALTPFEFQKLLNNLTSIKIRGTYSE
RSAGYLDDVTLASARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCV
LCTCNGHSETCDPETGVCNCRDNTAGPHCEKCSDGYYGDSTAGTSSDCQPCPCPGGSSCA
VVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNC
NRLTGECLKCIYNTAGFYCDRCKDGFFGNPLAPNPADKCKACSCNPYGTVKQQSNCNPVT
GQCECLPHVTGRDCGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITG
QHCERCEVNHFGFGPEGCKPCDCHPEGSLSLQCKDDGHCECREGFVGNRCDQCEENYFYN
RSWPGCQECPACYRLVKDKVADHRVKLQELESLIANLGTGDEMVTDQAFEDRLKEAEREV
MDLLREAQDVKDVDQNLMDRLQRVNNSLSSQISRLQNIRNTIEETGNLAEQARAHVENTE
RLIEIASRELEKAKVAAANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAK
TANDTSTEAYNLLLRTLAGENQTAFEIEELNRKYEQAKNISQDLEKQAARVHEEAKRAGD
KAVEIYASVAQLSPLDSETLENEANNIKMEAENLERLIDQKLKDYEDLREDMRGKELEVK
NLLEKGKTEQQTADQLLARADAAKALAEEAAKKGRDTLQEANDILNNLKDFDRRVNDNKT
AAEEALRKIPAINQTIIEANEKTREAQQALGNAAADATEAKNKAHEAERIASAVQKNATS
TKAEAERTFAEVTDLDNEVNNMLKQLQEAEKELKRKQDDADQDMMMAGMASQAAQEAEIN
ARKAKNSVTSLLSIINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLE
NEAKKQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences ENSMMUP00000019767 ENSMMUP00000019767 9544.ENSMMUP00000019767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]