SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019777 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019777
Domain Number 1 Region: 153-261
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-25
Family Cadherin 0.00044
Further Details:      
 
Domain Number 2 Region: 373-494
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-25
Family Cadherin 0.0024
Further Details:      
 
Domain Number 3 Region: 262-378
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-25
Family Cadherin 0.00085
Further Details:      
 
Domain Number 4 Region: 74-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000157
Family Cadherin 0.0026
Further Details:      
 
Domain Number 5 Region: 482-590
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000072
Family Cadherin 0.0049
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000019777
Domain Number - Region: 579-649
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0439
Family Rhodopsin-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019777   Gene: ENSMMUG00000015092   Transcript: ENSMMUT00000021151
Sequence length 794
Comment pep:known chromosome:MMUL_1:6:21794035:22143868:-1 gene:ENSMMUG00000015092 transcript:ENSMMUT00000021151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRNCLSLLLWVLFDGGLLTPLQPQPQQTLATEPRENVIHLPGQRSHFQRVKRGWVWNQ
FFVLEEYMGSEPQYVGKLHSDLDKGEGTVKYTLSGDGAGTVFTIDETTGDIHAIRSLDRE
EKPFYTLRAQAVDIETRKPLEPESEFIIKVQDINDNEPKFLDGPYVATVPEMSPVGAYVL
QVKATDADDPTYGNSARVVYSILQGQPYFSIDPKTGVIRTALPNMDREVKEQYQVLIQAK
DMGGQLGGLAGTTIVNITLTDVNDNPPRFPKSIFHLKVPESSPIGSAIGRIRAVDPDFGQ
NAEIEYNIVPGDGGNLFDIVTDEDTQEGVIKLKKPLDFETKKAYTFKVEASNLHLDHRFH
SAGPFKDTATVKISVLDVDEPPVFSKPLYTMEVYEDTPVGTIIGAVTAQDLDVGSSAVRY
FIDWKSDGDSYFTIDGNEGTIATNELLDRESTAQYNFSIIASKVSNPLLTSKVNILINVL
DVNEFPPEISVPYETAVCENAKPGQIIQIVSAADRDLSPAGQQFSFRLSPEAAIKPNFTV
RDFRNNTAGIETRRNGYSRRQQELYFLPVIIEDSSYPVQSSTNTMTIRVCRCDSDGTILS
CNVEAIFLPVGLSTGALIAILLCIVILLAIVVLYVALRRQKKKDSLMTSKEDIRDNVIHY
DDEGGGEEDTQAFDIGALRNPKVIEENKIRRDIKPDSLCLPRQRPPVEDNTDIRDFIHQR
LQENDVDPTAPPYDSLATYAYEGTGSVAESLSSIDSLTTEADQDYDYLTDWGPRFKVLAD
MFGEEESYNPDKVT
Download sequence
Identical sequences F7HPS8 G7P7A5
XP_005556676.1.63531 XP_005556679.1.63531 XP_014995253.1.72884 XP_014995254.1.72884 XP_014995255.1.72884 ENSMMUP00000019777 9544.ENSMMUP00000019777 ENSMMUP00000019777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]