SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000019791

Domain assignment for ENSMMUP00000019791 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSMMUP00000019791
Domain Number 1 Region: 437-694
Classification Level Classification E-value
Superfamily YWTD domain 7.85e-49
Family YWTD domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000275
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 3 Region: 148-188
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000012
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 4 Region: 270-306
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 5 Region: 70-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 6 Region: 187-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000106
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 7 Region: 107-149
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00019
Further Details:      
 
Domain Number 8 Region: 234-268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 9 Region: 390-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000729
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 10 Region: 354-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 11 Region: 312-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 12 Region: 698-744
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000984
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019791   Gene: ENSMMUG00000015093   Transcript: ENSMMUT00000021165
Sequence length 839
Comment pep:known chromosome:MMUL_1:15:74586509:74619170:-1 gene:ENSMMUG00000015093 transcript:ENSMMUT00000021165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGTSARWALWLLLALCWAPWESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPNRWKCDGDPDCEDGSDESPEQCHMRTCRINEISC
AAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPSEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGVHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGTSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDG
SDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGG
CSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQ
MDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWA
DLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTK
RKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQWPNGIT
LDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEA
VYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQIN
DHSPKYTCSCPNGFNLEENGRDCQRINVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVG
GYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences ENSMMUP00000019791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.