SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Macaca mulatta 76_1 > ENSMMUP00000019793

Domain assignment for ENSMMUP00000019793 from Macaca mulatta 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSMMUP00000019793
Domain Number 1 Region: 317-574
Classification Level Classification E-value
Superfamily YWTD domain 6.15e-49
Family YWTD domain 0.000000105
Further Details:      
 
Domain Number 2 Region: 150-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 3 Region: 31-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 4 Region: 67-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 5 Region: 114-148
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000524
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 6 Region: 270-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000062
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 7 Region: 192-229
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 8 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000511
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 9 Region: 578-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000745
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019793   Gene: ENSMMUG00000015093   Transcript: ENSMMUT00000021167
Sequence length 747
Comment pep:known chromosome:MMUL_1:15:74586516:74619071:-1 gene:ENSMMUG00000015093 transcript:ENSMMUT00000021167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MGTSARWALWLLLALCWAPWESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVV
DGSDELDCAPPTCGVHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGTSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDG
SDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGG
CSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQ
MDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAAQKLFWA
DLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTK
RKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTVDIQWPNGIT
LDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEA
VYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQIN
DHSPKYTCSCPNGFNLEENGRDCQSTATTVTYSETKDTNTTEISPTSGLVPGGINVTTAV
SEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLS
IDIGRHSASVGHTYPAISVVSTDDDLA
Download sequence
Identical sequences ENSMMUP00000019793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.