SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020071 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020071
Domain Number 1 Region: 24-59
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000356
Family Calponin-homology domain, CH-domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020071   Gene: ENSMMUG00000015306   Transcript: ENSMMUT00000021459
Sequence length 180
Comment pep:known chromosome:MMUL_1:19:782762:784018:1 gene:ENSMMUG00000015306 transcript:ENSMMUT00000021459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRRH
LYDPKNHILPPMDHSTISLQMGTNKCASQVGMTAPGTRRHIYDTKLGTDKCDNSSMSLQM
GYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGAGDCPDPGEVPEYPPYYQEEAGY
Download sequence
Identical sequences 9544.ENSMMUP00000020071 ENSMMUP00000020071 ENSMMUP00000020071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]