SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020078 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020078
Domain Number 1 Region: 46-243
Classification Level Classification E-value
Superfamily L domain-like 8.75e-40
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 2 Region: 539-631
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.88e-25
Family Calponin-homology domain, CH-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020078   Gene: ENSMMUG00000015311   Transcript: ENSMMUT00000021467
Sequence length 683
Comment pep:known scaffold:MMUL_1:1099548049144:57503:69323:-1 gene:ENSMMUG00000015311 transcript:ENSMMUT00000021467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAPLAARGEEAAATTSVPGSPGLPGSRSAERALEEAVATGTLNLSNRRLKHFPRG
AARSYDLSDITQADLSRNRFPEVPEAACQLVSLEGLSLYHNCLRCLNPALGNLTALTYLN
LSRNQLSLLPPYICQLPLRVLIVSNNKLGALPPDIGTLGSLRQLDVSSNELQSLPVELCG
LSSLRDLNVRRNQLSTLPEELGDLPLVRLDFSCNRVSRIPVSFCRLRHLQVILLDSNPLQ
SPPAQVCLKGKLHIFKYLSTEAGQRGSALGDLAPSRPPSFSPCPAEDLFPGHRYDGGLDS
GFHSVDSGSKRWSGNESTDEFSELSFRISELAREPRGPRERREDGSADGDPEQIDFIDSH
VPGEDEERGTVEEQRPPELSPGAGDRERAPSSRREEPAGEERRRPDTLQLWQERERRQQQ
QSGAWGPPRKDSLLKSGLRSAVGGATAMSTQATHNGPPKSSASQAGATVGQGAPAPAPAS
QEPLPIAGPATAPAPRPLGSIQRPNSFLFRSSSQSGSGPSSPDSVLRPRRSPQIPDEKDL
MTQLRQVLESRLQRPLPEDLAEALASGVILCQLANQLRPRSVPFIHVPSPAVPKLSALKA
RKNVESFLEACRKMGVPEADLCSPSDLLQGTARGLRTVLEAVKRVGGKALPPLWPPSGLG
GFVIFYVVLMLLLYVSYTRLLGS
Download sequence
Identical sequences G7MNU9
9544.ENSMMUP00000020078 ENSMMUP00000020078 XP_014989952.1.72884 ENSMMUP00000019666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]