SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020195 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020195
Domain Number 1 Region: 679-985
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-79
Family Protein kinases, catalytic subunit 0.0000000587
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020195
Domain Number - Region: 10-88
Classification Level Classification E-value
Superfamily Cadherin-like 0.0143
Family Cadherin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020195   Gene: ENSMMUG00000015400   Transcript: ENSMMUT00000021591
Sequence length 1094
Comment pep:known_by_projection chromosome:MMUL_1:9:43248670:43276380:1 gene:ENSMMUG00000015400 transcript:ENSMMUT00000021591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPTVALGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDAPEEVPSFRLGQHLYGTYRTRL
HENNWICIQEDTGLLYLNRSLDRSSWEKLSGRNRGFPLLTVYLKVFLSPTSLREGECQWP
GCARVYFSFFNTSFPACTSLKPRELCFPETRPSFRIRENRPPGTFHQFRLLPVQFLCPNI
SVAYRLLEGECRPCGATPQGSPVSTQRGLALGGWEPWVYIAPVTQRVSGSRKVTGPGWPV
TPWELESRSTVPIPGSDNAHLVHLWAAWDDTVVATLRVFDADVVPASGELVRRYTSTLLP
GDTWTQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNRNLSISENRTMQLAVLVNDSD
FQGPGAGVLLLHFNVSVLPVSLHLPSSYSLSVSRRARRFAQIGKVCVENCQAFSGINVQY
ELHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAELHYMVVATNHQTSRQAQAQL
LVTVEGLYVAEEAGCPLSCAVSKRRPECEECGGLGSPTGRCEWRQGDGKGITRNFSTCSP
STKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPRGIKAGYGTCNCFPEEEKCFC
EPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHRYHKFAHKPPIPSAEMTFRRPA
QAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVK
ATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLKQVNHPHVIKLYGACSQDGPL
LLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDHPDERALTMGDLISFAWQISR
GMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAI
ESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEM
YRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAASTPSDSLLYDDGLSEEETPL
VDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRADGTNTGFPRYANDSVYANWM
LSPSAAKLMDTFDS
Download sequence
Identical sequences ENSMMUP00000020195 ENSMMUP00000020195 9544.ENSMMUP00000020195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]