SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020210 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020210
Domain Number 1 Region: 5-90
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-23
Family PDZ domain 0.0000183
Further Details:      
 
Domain Number 2 Region: 319-348
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000218
Family LIM domain 0.00076
Further Details:      
 
Domain Number 3 Region: 288-318
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000166
Family LIM domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020210   Gene: ENSMMUG00000015407   Transcript: ENSMMUT00000021606
Sequence length 364
Comment pep:known chromosome:MMUL_1:5:177600783:177634901:-1 gene:ENSMMUG00000015407 transcript:ENSMMUT00000021606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILAIDGFGTESM
THADAQDRIKAAAHQLCLKVDRAETHLWSPQVSEDGKAHPFKINLESEPQDVNYFEHKHN
IRPKPFIIPGRSSGCSTPSGIDCGSGRSTPSSVSTVSTICPGDLKVAAKLAPNIPLEMEL
PGVKIVHAQFNTPMQLYSDDNIMETLQGQVSTALGETPLMSEPTASVPPESDVYRMLHDN
RNEPTQPRQSGSFRVLQGMVDDGSDDRPAGTRSVRAPVTKVHGGSGGAQRMPLCDKCGSG
IVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFIEGELYCETHARARTKPPEGYDTVTL
YPKA
Download sequence
Identical sequences A0A1D5RF04 A0A2K5U1J5 A0A2K6E902
ENSMMUP00000020210 9544.ENSMMUP00000020210 ENSMMUP00000020210 XP_005556497.1.63531 XP_011713878.1.29376 XP_014995046.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]