SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020217 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020217
Domain Number 1 Region: 41-257
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.12e-62
Family Gamma-glutamyltranspeptidase-like 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020217   Gene: ENSMMUG00000015415   Transcript: ENSMMUT00000021613
Sequence length 257
Comment pep:novel scaffold:MMUL_1:1099214343257:34:842:1 gene:ENSMMUG00000015415 transcript:ENSMMUT00000021613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLKTQVFLQKLRLISKTLKKISKTILIFLLLTIIGCNNIEVKYSNSIISSPHPLASEAGR
YIYSKGGNAFDAAVASAFALSVVEPSMSGIGGRIQVIFKTQDGVISGIDGTTQIPKSFYS
DDDLPSFGYKTIGIPGVVSGLLMLHEENGQLDLETIMQPAIKYAEDGFMLLPGEILRQKY
EKDKLESFEGSKIYFLDSIGNSFDIGDRIIQKDLANTLKIISKEGKNGFYEGEIAKKIVD
DIQKNGGFITLEDLKNY
Download sequence
Identical sequences ENSMMUP00000020217 9544.ENSMMUP00000020217 ENSMMUP00000020217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]