SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020262 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020262
Domain Number 1 Region: 4-154,200-310
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.05e-51
Family Calponin-homology domain, CH-domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020262   Gene: ENSMMUG00000015448   Transcript: ENSMMUT00000021662
Sequence length 312
Comment pep:known_by_projection chromosome:MMUL_1:10:87999662:88162611:1 gene:ENSMMUG00000015448 transcript:ENSMMUT00000021662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPALADVHPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLE
EDLYDGQVLQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVD
SIHGKNLVAILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEM
MMGRFERDAFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLM
GLLEDYFVPLHNFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRV
LYNLFTKYKNVE
Download sequence
Identical sequences A0A2K5WDT2
ENSMMUP00000020262 ENSMMUP00000036932 XP_011710392.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]